CAZyme Information: TSTA_114590-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_114590-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: cell wall glucanase (Scw4), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	EQ962655|CGC17	45795.28	6.4072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:956224-957585(+)

Full Sequence      

MKYCILGIAALALLHSTDGHVHKEALKRRQDHHQLSKRVLWQGRAAQPCPKETLTNTVVV
QLDQAGHTVDVQVHSARPSSTVTVSDHHAPPSISSTTAIVPSSASRTILQSNRHILPRPS
ALSHLPDLLDSNFILDAPNAFLGRSNYGISYSPYKADGTCKDQAEVSNDIRQLRQFAYVR
FYGIDCNQALTVTNAARENDMMVFAGLYDIDDIETDLQKIIDAAGGDWSTFHTVSIGNEL
VNRGSKSPVEVVGTVNSARTILRRAGYQGPVVTVDTFTQMIAHPELCDESDYCAANCHAF
FDSAQTPENAGPYVLEQARHVVEATKGGNKKVIITETGWPSAGEPNGKAVPSRHNQMIAF
QSLRHSFPDGGIVFFSAFDDKWKEDNAWTFGTETHWGLYGLAKTAGGFPSLIGPLEDEV

Enzyme Prediction     

No EC number prediction in TSTA_114590-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	155	400	8.2e-23	0.9389067524115756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.58e-73	94	399	8	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.60e-07	322	399	219	297	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16381.1|GH17	1.60e-227	1	418	1	407
QKX63568.1|GH17	5.28e-138	1	404	1	418
ACQ00076.1|GH17	3.57e-103	50	403	19	366
BCS24296.1|GH17	4.39e-96	147	401	111	365
CAK47997.1|GH17	5.83e-96	147	398	110	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.72e-13	147	400	38	283	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.03e-12	147	400	38	283	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	5.15e-70	148	399	128	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.79e-65	148	398	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	1.10e-63	148	398	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q4WC60|BTGE_ASPFU	1.33e-36	148	399	310	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	1.33e-36	148	399	310	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999714	CS pos: 19-20. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in TSTA_114590-t26_1-p1.