CAZyme Information: TSTA_113120-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_113120-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: periplasmic beta-glucosidase precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		66221.27	4.9601

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:554126-556020(-)

Full Sequence      

MGVRWVLSPELDVGREPRYGRVGEMYGEDQYLNGVFGTSYVKTMEEKDEKGYMKVATTIK
HFVYGVPTGGINTASQSGGLNHLFNDLVAPFATVIKEAQPASVMISYASIDCEPMSVNKF
MMQTVLRQKLDFDGVFMSDALAILHLHTQSKVAKSLEDAALRALKAGLQLELSPAQPAAF
PTLVSSTNIAWVRERIDDAVLRILKIKFQTGLFDEELPQIADAQATLRLEAHLAINRNMS
RESIVLLQNDGILPLTKNKNGTWPKTAIIGPFANIINPGSYAPNNSTDRSFGKSLYQSMV
SAFSFDRVSFTQGADIIGNDTSGIKAAVQAAKEAGLAVLMLGSLSVITADPLFNERRDGE
FFTHADLGFPGRQQDLLDAILATGVPTVVILSGGQAFVLNDHTLQSNAILHSFLGGEYTT
DALVEILTGEVNPSGKLTISMPQSSSTIPVYYNYLPSDNQGGVAGIAPGNFTTAWQFPSL
PTPPTMAFGYGLSYTTFKYSNAQISSGESINLTVDITNTGNMTGKEVVQLYFRPEFSVIE
TPVKKLIRFEKIELAPGETVTVDFTVPTWDLGYYRHMAWEVETGAYSFWVGSSSRDHDLI
YLNATVV

Enzyme Prediction     

No EC number prediction in TSTA_113120-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	172	1.6e-37	0.7222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.81e-101	8	596	156	756	beta-glucosidase BglX.
178629	PLN03080	6.34e-49	8	566	155	742	Probable beta-xylosidase; Provisional
224389	BglX	1.31e-47	1	284	112	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.32e-36	244	494	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.64e-34	1	206	117	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW30508.1|GH3	6.96e-231	1	607	162	761
UDD59312.1|GH3	9.86e-231	1	607	162	761
QMW42566.1|GH3	2.80e-230	1	607	162	761
CCT75117.1|GH3	3.33e-226	1	606	164	769
QGI87496.1|GH3	3.33e-226	1	606	164	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	4.02e-75	1	596	145	747	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.88e-74	1	596	145	747	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXL_A	1.18e-66	2	596	130	743	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.95e-66	2	596	130	743	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	3.10e-65	2	573	173	752	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH0|PLH24_FORAG	3.57e-76	1	606	119	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.48e-73	2	594	150	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	2.04e-72	2	594	150	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	3.23e-69	2	597	171	747	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|A7LXU3|BGH3B_BACO1	2.23e-64	3	596	176	767	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000052

TMHMM  Annotations     

There is no transmembrane helices in TSTA_113120-t26_1-p1.