CAZyme Information: TSTA_105640-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_105640-t26_1-p1
• CAZy Family: GH95
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		29648.41	5.0109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962658:2302113-2303094(+)

Full Sequence      

MNYRSLISYTALAVFITSVLVWLRSYHSLPAISISKPVHSPMYWFAFLAIAGATIDDSLA
TWGFGDMTSQIDAFHLFYASRPESAPWTADSTIASFWIGINDVYYGFAHEDEPYDFVSTL
MNRYRPLIEQIYSNEIRKFLFLNCPPSTHSPQVHEENDLPEQFQRHAEMMTAYNKALNSM
LFQFRGEHKDATVVFYDSFQYMARILDNPAQYGYQDATCMNTDGSNCVWWNNLHSGWKYH
QYQAEDMLPILAPLGW

Enzyme Prediction     

No EC number prediction in TSTA_105640-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	48	247	3.6e-54	0.7715355805243446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	4.49e-34	49	248	61	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	5.72e-16	49	218	81	262	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	8.15e-08	96	216	84	208	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	1.13e-05	39	252	102	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	4.74e-04	49	237	64	253	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19551.1|CE16	1.82e-151	1	256	1	311
QKX60132.1|CE16	6.45e-114	1	256	1	310
QMW25447.1|CE16	1.82e-59	48	255	91	296
QMW37516.1|CE16	1.82e-59	48	255	91	296
UCK57868.1|CE16	1.82e-59	48	255	91	296

PDB Hits     

TSTA_105640-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	8.19e-24	70	245	118	291	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	8.19e-24	70	245	118	291	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000000

TMHMM  Annotations     

Start	End
5	27
42	64