CAZyme Information: TSTA_102350-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_102350-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: aryl-alcohol dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610	EQ962658|CGC5	65630.26	5.5889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962658:1398786-1400692(-)

Full Sequence      

MAHSVTSLPDFLEDSYPFDYVIVGGGTAGLVLAARLTEDPSIRVGVIEAGKSRLGDMNVD
MPTGMSAVLHNPEYDWMYKSTPQAGTNNQIHHVARGKLVGGSSGVNFLAYCRPSAEDIDY
WGKLGNKGWSWTELAPYYHKSETQDENSGKQAAGKADFYSQDSVFHGHSGPIKTSFPPWR
VPVEDSIMEAFDEVSGVARPKDPWSGNHVGFYGTLSTIDRKDNKAVRSYAATGYLQPNIE
RKNLKVLTDATVTKVLLDQDTSTAKGVEFLYEKATYQVLTTTEVILSASSIQSPRLLELS
GIGDPKVLQAAGVDCVIQLPGVGSNLQEHPMTSVTYELAPDQISLDSLFKDPSLLQEHQQ
LLGEKGSGAFAGTMSLTGFLPYPTIVSPQEVEETAAKITKSTAPIPEVEAENIISHLRSP
KSAAVQFTGVPANFDLVVGHGNQGKLMPGAPPGRNACYTALVSLAYPLSRGSTHILSSDP
FLDPEIDLGLLAHPADAHVLAAGLGFVDRVFQSPRIKKKIAGRIDPGPEVDLQDREQGIS
FARDRTMTFNHLLGTCAMGIVVDERLRVKGVNGLRVVDASVIPAQVGGNILATVYAIAEK
AADMIKADRT

Enzyme Prediction     

No EC number prediction in TSTA_102350-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	18	608	8.1e-173	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.85e-110	18	606	6	532	choline dehydrogenase; Validated
225186	BetA	3.69e-107	18	609	8	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	4.05e-62	19	605	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.70e-33	467	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.86e-32	18	609	56	580	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47931.1|AA3_2	1.57e-221	7	608	5	617
UBX54549.1|AA3_2	2.45e-215	4	606	2	608
BCS02582.1|AA3_2	3.20e-211	6	606	8	614
BCS14253.1|AA3_2	3.20e-211	6	606	8	614
UPX44764.1|AA3_2	2.66e-207	8	608	6	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	2.18e-73	18	606	6	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	2.75e-69	18	608	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.56e-65	18	609	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.89e-64	18	609	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5NCC_A	2.36e-61	2	610	2	581	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.70e-205	6	608	4	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.45e-200	10	608	8	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.45e-200	10	608	8	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.62e-81	15	608	37	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.90e-79	14	605	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999907	0.000128

TMHMM  Annotations     

There is no transmembrane helices in TSTA_102350-t26_1-p1.