CAZyme Information: TSTA_101460-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_101460-t26_1-p1
• CAZy Family: GH74
• CAZyme Description: alpha-L-fucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	EQ962658|CGC12	89213.35	5.1127

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962658:1174281-1176807(-)

Full Sequence      

MKLDSAAFSVLGLTLLTVAQADQNVQQTLSSQLTSISLAPYFNNKAFGSHPGFAAFDTLN
ESYPDPSIIGIKGSYTSKVTGITYEFPSVRPAGVPDNVICEGQIITVPNSRYFSASILVS
SDVELSTVSGNVTYTYSDNSTMVSELRSLPWFAFLTINRGEIIFPFRYTANGKNFNTTHI
FEYTAALDPSKTLSSITLPNTNNATTGRLHIFAVSLWNAASASAQVQNVRPTQKWTAEGN
QVVEVTINNSGLDCISGDGLNISISMPGVQTLEPGNIRRLCPGDQKRVDVGVNGTGNGKV
DILLSHSRFSVQQEFTNVSIGLTKWTSDLSNLARHESPQWYDDAKFGLFIHWGPYSVPGW
GNSTPYESYAEWFWWYTTHREADKSDFYNYRLRTFGPDWNYDDSFANFTASNWDPKAWVD
LIYASGAKYFVLTTKHHDGFALFNTSSTTDRNSLLYGPHRDIVQELFSAAEAYQPDLRRG
TYFSLPEWFNPDFGPYGFAQLPGNTSTSWPGIIARNPYTGRDEPYTGRLPINDFITDLMV
PQMEILAYNYSTDILWCDCGAANGTAPFAAAWWNHARAQNRQVTINSRCGLAEAADFDTP
EYMTFSSAQRRKWESNEGMDPYSYGYNRATPNSSYMNATTIVQDLVDMVSKNGNFLLDIG
PRADGSIVEAEANNLRMAGEWIHSHAEAIFNTTYWFVMSKIADQGIRFTQTNDAFYILFL
TKPTCPDIYIDAPLPLLNGDVVSVVGENKSEPHITWENLRKHNQKGGSSSAPGSGFRFHI
PETAWEGEKYCWVLKISYKA

Enzyme Prediction     

No EC number prediction in TSTA_101460-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	318	691	2.6e-89	0.9393063583815029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	1.64e-96	323	724	5	375	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	1.51e-92	331	687	12	333	Alpha-L-fucosidase.
226195	AfuC	2.88e-44	351	732	1	364	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54848.1|GH29	0.0	32	800	26	797
BCR93111.1|GH29	0.0	31	800	21	789
BCS05767.1|GH29	0.0	31	800	21	789
QDS68271.1|GH29	0.0	24	800	23	786
UQC79540.1|GH29	0.0	28	800	48	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ODU_A	6.98e-58	324	731	7	399	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
1HL8_A	6.98e-58	324	731	7	399	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
2ZWY_A	8.05e-58	324	731	7	399	alpha-L-fucosidase [Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]
2WSP_A	6.58e-57	324	731	7	399	Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8],2WSP_B Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8]
7LJJ_A	6.49e-44	303	713	21	423	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17164|FUCO_RAT	2.86e-59	325	759	33	433	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
sp|Q2KIM0|FUCO_BOVIN	2.96e-57	324	797	39	465	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1
sp|Q9BTY2|FUCO2_HUMAN	5.48e-57	323	762	32	439	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
sp|Q5RFI5|FUCO2_PONAB	7.21e-57	323	762	30	437	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
sp|Q99LJ1|FUCO_MOUSE	2.64e-56	318	733	16	399	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999755	CS pos: 21-22. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in TSTA_101460-t26_1-p1.