CAZyme Information: TSTA_101400-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_101400-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		100960.39	5.8226

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962658:1161280-1164437(+)

Full Sequence      

MAQESLVTFHWHDESVSLSEACILDQNDFEGIHIATSRLSKDFGAVTGSELKTVYCNEST
VFPDRSSCIIVGSLLCSSLIQNLVHDGKLAVDDIEEKWESFAMTVVDLPLPGVRKALVIA
GSDKRSTIYGIYSLSEHIGVSPWYWWADVVPEKKSEIFIRRGRLQYGEPSVKYRGIFIND
EAPSLTGWVLEKFGPKYNVKFYEKLFELLLRLKANFLWPAMWPGYPNSGNSFFVDDELNQ
KTAHAWGIAVSTSHHEPMQRAMAEWFAENPEGSWTWTKNKEKIQRYFRDGAARAKDYESY
ITLGMRGDGDRAMTVDDPPAVLREILTYQRSVINDVLGMELLALYKEVQEYFENGLSVPD
DVTLLFADDNFGNIRRLPVGVEADRAGRAGVSIKKSIPGLPYAWDINSVPANNFMSFFQG
FADQTISSSVSDETARLLYEADRLISLRKHEHIEANTFSILNYGEAEGIVNTWESLLDKA
TELNSKLTPEQQPAFFQLVLHHIKASYIYTKLRVTQAKNCLFGLQRRNETNKMAQQVLEL
FDADFDLAQEYHSLLDGKWNHMLRQPHYGYRDTWHAPSRDMIDGLGYIQVKQGSNPIVRH
MGLSVKGTQGIRPGLTNEESDRTHPSRGDLVPGLTLPPLEPYGTQVRFFEIYRRGTASFT
WCVSSPHDWVKVAPSSGRLDNDTNDARVHVGIDWPNVPAHFNQVIQITISSSAGDYEHVH
LPVIHRDVPDKSFCGFVESDNCVSIPATEFSHMQNTNRSRGLVPHPLSLILFFTMALDIN
PKEPLVYEAMIDDISFGTLRLIEDPAKVGDLPPRWDEAVQDYVWKRTLLVPDSLYRGRHV
IKVRFSQQNVLLEKIVLDLGGVRESYLGPLKSTLVGKTGNFSIEVSTCTLGFP

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	22	584	1.2e-181	0.8278335724533716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	1.35e-132	167	452	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	1.34e-30	735	869	1	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23930.1|GH115	0.0	15	872	15	964
BAE65957.1|GH115	0.0	16	872	16	961
QMW48785.1|GH115	0.0	16	872	16	961
QMW36729.1|GH115	0.0	16	872	16	961
QRD92204.1|GH115	0.0	16	872	16	961

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	9.38e-159	23	877	26	938	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	8.43e-122	23	574	29	635	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.46e-119	23	574	28	634	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	7.38e-103	24	570	57	647	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	8.05e-79	25	877	25	968	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

TSTA_101400-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999419	0.000609

TMHMM  Annotations     

There is no transmembrane helices in TSTA_101400-t26_1-p1.