CAZyme Information: TSTA_099090-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_099090-t26_1-p1
• CAZy Family: GH64
• CAZyme Description: endo alpha-1,4 polygalactosaminidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	EQ962658|CGC18	39807.40	4.1622

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962658:542235-543365(+)

Full Sequence      

MDPLLILDLEKFQPRIMVAWPTVFGLTGYFAAVFETEDFLHNLKAAYPKTSIPDPDNPRT
TTMMSDMVKIASTGQGSWSAIITTVIASIAVLASPTSGASSDSACNATTINSNTYWQPTA
GTTWQIELLYKLNDTSVDVQVYDIDLFDTDADQISSLQAAGRKVICYFSAGSWENWRPDA
DQFNSADLGGDLDGWAGEKWLNISSDSVRKIMTARLNMASQKGCDGVDPDNVDGYSNKEN
ALDLTQEQSIGYVNFLAKEAHSRNMAIGLKNAGDIIESVLDNMQWSVNEQCVQYGECDKY
TPFTDANKPVFHIEYPKGEDVNNDKDVTDAQKKKACVFEGSEKFSTVIKNMDLDNWVQFC

Enzyme Prediction     

EC	3.2.1.109:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	124	315	5.5e-79	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	3.81e-115	123	354	1	220	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	2.44e-24	123	277	62	221	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	1.48e-06	132	337	39	276	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21045.1|GH114	2.51e-155	114	360	55	301
QKX57459.1|GH114	1.08e-136	111	360	70	318
CAK44466.1|GH114	6.20e-125	116	360	80	323
XP_754825.1|GH114|3.2.1.109	1.61e-121	116	360	75	318
ACQ04363.1|GH114	1.90e-121	116	360	80	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	1.35e-123	116	360	34	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	2.43e-123	116	360	51	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

TSTA_099090-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_099090-t26_1-p1.