CAZyme Information: TSTA_098490-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_098490-t26_1-p1
• CAZy Family: GH64
• CAZyme Description: class III chitinase ChiA2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	EQ962658|CGC6	41711.96	4.0413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962658:371151-372412(-)

Full Sequence      

MKTSTALICLGLMASAVIAAPHRLQARGPGGEVVVYWGQNAAAASENNDLSTYCTTDSGI
DIVVLSFLYEYGNGNTIPAGVIGNDCSISTSGQGTNCDALASQIATCQSNGVKVILSLGG
AVGAYSLTSQAEAETIGQNLWDAYGKSSGGSIPRPFGSTFVNGWDFDIEANSGNQYYQYM
ISKLRSNFASDSSNTYYITGAPQCPIPEPNMGEIIQNAQFDYLWVQFYNNGYCSYPNTLN
YADWVSYVSGTPSANAKIFIGVPASELGSTGTQSGAVYYQSPSVLASTVASFDTSSNWGG
IMMWDAAFSDANVINGCNYAQQAHSILKTGSPCGGSGTTPPSTTTTPTQTTSTATATVTA
TGVPVPQWGQCGGEGYTGSTVCATPYTCVKESQYWSSCQ

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	32	307	3.3e-24	0.9256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	7.69e-102	31	325	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	5.24e-14	33	316	2	272	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	7.66e-12	61	304	29	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
197593	fCBD	2.64e-09	366	399	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	3.71e-09	367	395	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21006.1|CBM1|GH18	5.83e-243	1	399	1	397
QKX63710.1|CBM1|GH18	2.21e-197	1	399	1	411
EAL85097.1|GH18	1.11e-164	1	333	1	334
ACQ02288.1|GH18	5.29e-163	1	333	21	354
UKZ86462.1|CBM1|GH18	1.02e-158	11	399	14	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	4.97e-65	33	331	8	291	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2XVN_A	4.96e-45	33	327	3	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	5.08e-45	33	327	4	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
4TX6_A	5.08e-45	33	327	4	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
1HVQ_A	8.39e-43	31	312	1	263	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9F9R9|CHI2_METRA	3.28e-158	29	399	33	419	Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi2 PE=3 SV=2
sp|Q4U4T0|CHI2_METAN	2.17e-156	29	399	33	419	Endochitinase 2 OS=Metarhizium anisopliae OX=5530 GN=chi2 PE=1 SV=1
sp|P29029|CHIT_YEAST	2.04e-61	33	331	29	312	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2
sp|P40954|CHI3_CANAL	1.49e-50	33	332	25	315	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2
sp|P40953|CHI2_CANAL	9.90e-50	12	327	7	302	Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999753	CS pos: 27-28. Pr: 0.9252

TMHMM  Annotations     

There is no transmembrane helices in TSTA_098490-t26_1-p1.