CAZyme Information: TSTA_098220-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_098220-t26_1-p1
• CAZy Family: GH63
• CAZyme Description: glycosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	EQ962658|CGC11	40247.38	8.3051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962658:294599-295757(+)

Full Sequence      

MTMPCLRVKIFIVVCVALFLSQKWWLPLGHTLFNLVALSSRWRQASVQSFISKDRDDFDV
TFASYPVNQSTAGSGYQDLIPPILHHIHLGPHEPRPEWMGARDECIRYHPNWKAYIWDDD
SAEKLVNEEFPHLSDMWKDYRYPVERVDALRYMVLQTYGGVVLDFDLACKRSLGPLRRFE
FVAPAAHPTGFSIGFMMASQGNEFVRDLVDNLTRYNHVWFYLPYVAVMFSTGCHYASTIF
TLQENRNPLRILGGITGSPRLHMLNGFVDTPLFRHLGSSSWHNFDAALINWIGHLRSGSI
IISLIFVASLLLTVYVTRLCLRRRRCSAARDKAMGDRFDSERGFSCIKEA

Enzyme Prediction     

No EC number prediction in TSTA_098220-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	98	177	2e-16	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.51e-19	76	306	78	305	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.06e-11	97	180	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20976.1|GT32	1.36e-223	3	350	1	347
QKX57091.1|GT32	2.55e-157	3	327	1	327
QMW48357.1|GT32	4.26e-120	3	332	1	327
UDD65563.1|GT32	6.04e-120	3	332	1	327
QRD92706.1|GT32	2.44e-119	3	332	1	327

PDB Hits     

TSTA_098220-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	3.08e-34	61	325	45	303	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	1.44e-32	79	289	54	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.58e-31	79	286	61	264	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	8.86e-30	68	294	52	267	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.62e-24	77	325	79	333	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.952007	0.047997

TMHMM  Annotations     

Start	End
218	240
299	321