CAZyme Information: TSTA_097190-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_097190-t26_1-p1
• CAZy Family: GH62
• CAZyme Description: glucose dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	EQ962653|CGC15	65127.12	4.8976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:4614887-4616848(-)

Full Sequence      

MRSSSLITTASLLSTVVGAINAANSTNTTSIKKNAALLGFDYDYIVIGGGTAGLVMASRL
SETARVAVIEAGGYYEVDNGNYSTVPGLALASPFLSTAEDYPANPKMDWGFLSASQPHAS
DRIIHYPQGKTLGGSSALNTMAYHRGTKGAYQLWADLVADQSYTFSNLLKYFQKSSHFTA
PNLTKRNTPNATVQYDATAFDNALGGPLQVSYSNYVDTTATWMARALQSIGLPESTVGFN
SGVLSGFGAWITMTIDPVNATRSSSQTSYLEHVANHKNLDVLSHTNVTRILIDPFSKTAF
GVEIVRQNGAVNFLVANEEVILSAGAFGSPRLLMLSGIGPADVLKEHRIPVFSNLPGVGQ
NLWDQVLVPVETGVNTPSGAQVEANPVTNAEAINEYLKDAAGPYSSPGAYIAFEKIPQEL
RSNFSSEAQSALAWFPSDWPEVEYVGGSTVNSDGVSQGVCTAVLVAPLSRGNVTIVSSNF
ADQPVIDMGWFSHPADREVAVAAIKRCREALASKEVASVVTGPEVVPGASIQTDDEILAF
AEAVATPIFHAAGTCAMGKKGDPNAVVDTQGRVFGVNSLRVVDSSIFPIAIPGHPQSSVY
MLAEKIADDIKSSTCS

Enzyme Prediction     

No EC number prediction in TSTA_097190-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	42	612	6.4e-173	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.08e-109	42	611	6	532	choline dehydrogenase; Validated
225186	BetA	2.08e-100	41	612	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.91e-43	467	606	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.93e-37	42	602	56	568	Protein HOTHEAD
366272	GMC_oxred_N	6.75e-25	122	365	17	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX52978.1|AA3_2	0.0	21	612	7	596
ATZ54862.1|AA3_2	8.77e-225	42	610	39	607
ATZ56755.1|AA3_2	5.90e-215	12	610	23	616
CAE7027645.1|AA3_2	1.57e-211	42	610	36	604
AEO67488.1|AA3_2	2.53e-187	42	610	33	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	5.35e-63	41	611	5	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	3.85e-57	39	604	38	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5NCC_A	8.49e-56	33	607	15	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	8.83e-56	39	607	5	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5OC1_A	9.62e-56	41	612	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	1.42e-160	42	611	41	608	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	1.42e-145	39	610	72	639	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	4.51e-143	42	610	51	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|C8VDT4|STCN_EMENI	1.77e-142	39	610	65	635	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	7.06e-139	42	610	52	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.429758	0.570239	CS pos: 22-23. Pr: 0.5206

TMHMM  Annotations     

There is no transmembrane helices in TSTA_097190-t26_1-p1.