CAZyme Information: TSTA_097170-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_097170-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: glucose dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	EQ962653|CGC22	60558.11	5.5900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:4609933-4611722(+)

Full Sequence      

MATEETGAFDIIIVGGGLAGCVVASRLRQRKPALSVLVIEAGDDLSENPHIYSPHKTALL
LGSDADWKYMSAPQTNLNGRSVYYQAGKGLSGSAAVNMGGWVRGDAQEYDQWADLVSDRR
WSYSGLLPYFKRTENYHNRHGDREQHGFDGPIHTSSVSSSGRQYPLRETTRQAWCNVGLK
VIADANNGRPQGVAELVSNWRDGRRQLTSEVYPQDGVKIVTNALVQRVILDSSQTATGVE
LADGRTYSVRSGGEVIISAGALRTPQILLLSGIGDSEQLSKHKIPALVHLPDVGRNFHDH
LMVFRYWKLREPEKGVAFGSPLFKGPNFEKGVPPEDWLVTTTVSSTGLQSALAKDENRSD
QVDQSLADRPHSHLELTTIYAAFGGELIGLNIPVDGSAIMNFYMGCLPTSRGSITLKSVD
PGDAPIIDPNFYATEADQFVMRAGWRLLSRLMLETPEGNDLVAEEIVPEGHRSLESDAPD
NLIDARIRMGGMTASHFAGTASMGSVVDGSLKVRDTQGLRVVDASVIPIPLASHYQVAVY
AIAEQAVDIILQENPSL

Enzyme Prediction     

No EC number prediction in TSTA_097170-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	552	2.2e-141	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.51e-95	1	555	1	536	choline dehydrogenase; Validated
225186	BetA	2.39e-90	9	555	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.20e-35	408	546	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.97e-32	75	301	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.36e-19	8	526	55	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16662.1|AA3_2	0.0	4	557	5	557
QKX52976.1|AA3_2	1.38e-311	1	557	6	562
ATZ56754.1|AA3_2	1.36e-191	5	550	3	544
CAK40717.1|AA3_2	1.95e-165	8	551	4	552
UKZ69664.1|AA3_2	2.15e-165	1	551	1	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	6.77e-58	5	556	2	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	3.54e-56	9	550	17	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	3.86e-52	9	550	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.93e-52	9	550	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	4.73e-52	9	557	7	576	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	6.13e-116	9	553	5	521	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|P64264|Y1310_MYCBO	9.64e-73	10	550	6	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	9.64e-73	10	550	6	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P9WMV4|Y1279_MYCTO	9.64e-73	10	550	6	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.80e-65	8	550	6	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000058

TMHMM  Annotations     

There is no transmembrane helices in TSTA_097170-t26_1-p1.