CAZyme Information: TSTA_094730-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_094730-t26_1-p1
• CAZy Family: GH54|CBM42
• CAZyme Description: sugar 1,4-lactone oxidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591		66735.55	6.5939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:3943599-3945421(+)

Full Sequence      

MSNDPAVARELSRLDPAVPFRATSQHLHFTWAKTFYSRPELYIQPQSIEEIQKAVTVARR
CRRRLVTVGSGHSPSDLTCTSAWLINLDNFNRVLDVSQETGLVTVQAGIRLRDLSRELQK
HGLSLPNLGSIDSQSIAGVIATGTHGSSSRHGLLSECIRGLSVTLANGQTVRCSATNNPE
LFRAALVSLGALGIVTEVTLQTVPAFRINWEQSLHPLSELLDRWEGDLWTSHEFVRAWWL
PYMDRAIIWHASKTDLPVQPPPKSWYGGWLGFHVYHNLLALSNWFPRFLPWVEWFVFGMQ
YGFKPGAVVTKAVEPAREGLLMDCLYSQFVNEWAIPLEKGPEAITRLSAWIHGDEKTARI
PFSPKGVWVHCPVEVRVSDTTLSSTPRPYLDPTSREGPTLYLNATLYRPYLRDPPCRERY
YEAFEWLMRDLGGRPHWAKNFTTLASAQDLRDMYGDDMDQWLKVRREVDPDGLFVGEWHR
RNLLLTSGDETESAELGDSHLSLGERQETVRKFGRRGAGDGLEWIGDRRWERASPVSLHK
GTIITDSPSPPMTSTSEESFDLLAPGEASFFYYKDGLGVIYADSISTCALH

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	30	210	8.9e-33	0.40829694323144106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273751	FAD_lactone_ox	2.63e-148	31	474	7	435	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
397924	ALO	6.08e-112	198	482	1	259	D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.
215258	PLN02465	3.25e-46	31	478	89	565	L-galactono-1,4-lactone dehydrogenase
223354	GlcD	7.95e-44	38	474	31	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.35e-38	39	174	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22693.1|AA7	1.30e-12	30	259	52	285
AEO63154.1|AA7	9.54e-12	39	202	62	228
AEO56694.1|AA7	9.75e-12	49	202	83	239
ANH22765.1|AA7	1.10e-11	18	202	95	286
CAI94231.1|AA7|1.1.3.-	1.03e-10	39	217	59	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7A24_z	1.26e-27	26	263	110	349	Assembly intermediate of the plant mitochondrial complex I [Brassica oleracea]
2VFR_A	9.89e-22	31	220	13	194	Alditol Oxidase from Streptomyces coelicolor A3(2): Native Enzyme [Streptomyces coelicolor A3(2)],2VFS_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Xylitol [Streptomyces coelicolor A3(2)],2VFT_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sorbitol [Streptomyces coelicolor A3(2)],2VFU_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Mannitol [Streptomyces coelicolor A3(2)],2VFV_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sulphite [Streptomyces coelicolor A3(2)]
3RJ8_A	6.90e-12	39	217	37	227	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
4AUT_A	1.98e-10	49	485	41	468	Chain A, Decaprenyl-phosphoryl-beta-d-ribofuranose-2- Oxidoreductase [Mycolicibacterium smegmatis],4F4Q_A Crystal structure of M. smegmatis DprE1 in complex with FAD and covalently bound BTZ043 [Mycolicibacterium smegmatis MC2 155]
6LPN_A	1.45e-09	31	204	46	228	Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPN_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SGY1|ALO_NEUCR	2.64e-211	5	526	13	548	Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1
sp|Q6CG88|ALO_YARLI	1.72e-129	26	485	13	526	D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALO1 PE=3 SV=1
sp|O93852|ALO1_CANAL	2.31e-116	19	485	10	555	D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=1 SV=1
sp|Q752Y3|ALO_ASHGO	8.36e-113	31	493	21	532	D-arabinono-1,4-lactone oxidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALO1 PE=3 SV=1
sp|Q6BZA0|ALO_DEBHA	1.93e-111	23	485	14	554	D-arabinono-1,4-lactone oxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_094730-t26_1-p1.