CAZyme Information: TSTA_094220-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_094220-t26_1-p1
• CAZy Family: GH53
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		46679.73	5.4115

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:3786684-3788199(+)

Full Sequence      

MKGLAILSALSSVAWAKHAVKTGLDVLIQSNYTQLAGRKVIALTNPTGVTPDLDLGVDVM
FNSGAVNLVGVMGPEHGFRGTAQAGGSEGTFVDPGTGLTVYDAYNVNTSTIVSYIKESGA
DTVLFDIQDVGARFYTYTWALYDTMVAAAVANVSFVVVDRPNPITGVNAFGPVLNESYAS
YVGRRPIAQAHGMTTGELASMFVGEKWIKQAANGSDLILEVIPMKGWKRSMTWKDTGLPW
VMPSPNMPTPDTALIYPGACMFEGTSISEGRGTTRPFEPQLLGGSFTNGSWVEKMRSLNI
PHTNFRSACFSPTTSKFQSQTVCGLQSYVFLDSTRDYEEFDSVYLGVSLLWSAKHLYTVG
NNDTGFGNTTQSFHWLFNGSNTSRYDVDVLAGGPLVREGIEAGLSPDEIRSQWEADLQAF
RKKRASYLLY

Enzyme Prediction     

No EC number prediction in TSTA_094220-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	43	430	2.9e-115	0.9887323943661972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399810	DUF1343	1.26e-174	43	430	3	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
226393	YbbC	5.29e-114	17	430	23	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].
237732	PRK14498	0.008	86	127	195	234	putative molybdopterin biosynthesis protein MoeA/LysR substrate binding-domain-containing protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18334.1|GH171	3.86e-279	1	430	1	425
CAK39216.1|GH171	2.29e-277	1	430	1	431
UNI16955.1|GH171	3.38e-208	16	430	20	434
BCK72268.1|GH171	3.61e-129	20	430	42	424
QIY54731.1|GH171	1.02e-128	17	430	39	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	1.62e-52	20	430	13	398	Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	8.26e-45	25	430	5	368	Crystal structure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

TSTA_094220-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000368	0.999621	CS pos: 16-17. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in TSTA_094220-t26_1-p1.