CAZyme Information: TSTA_092930-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_092930-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		45560.72	7.2700

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:3418336-3419582(-)

Full Sequence      

MFLLKKSRRFLLWIPIVLILFIFHYVFSIHNNRNGPHTDDNDTRPRFLYRSSFRDNPDLE
YERRISDALQGIEGTVLAENGGDTLAEERIWQIAKDEGQRGSDSKALQGQNRLWEYSLMT
DEKAEDFVNNILSAVPEIAQVYNSYPYYVLRTDLLRYLLLWYYGGFYADIDVFPARPIKG
CPDLKPVLFTDQKSTNISLVVGVELDEPYVSPRGMREWHWTRRYGFLQYTMFAPRRFSPV
LREIITRVMAHTKQHNERFASHFTGYGQSTILGITGPDVVTDAVLDVLSSTLPTMHKLMN
ISMNKDAGIDPLPISTDTGETLRRVTWAPFHGLSEPLCIADSEARQKGSMGGICVLPVNA
WGNGQRHSGSEGFDSPRACVNHRFSGSWKKGWWQSFFG

Enzyme Prediction     

No EC number prediction in TSTA_092930-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	110	180	1.5e-19	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.09e-06	63	247	59	242	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.43e-06	110	178	14	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18206.1|GT32	4.52e-233	4	398	12	407
QKX54668.1|GT32	3.42e-180	8	398	14	403
CAP98643.1|GT32	7.71e-157	6	398	16	421
QQK43033.1|GT32	2.99e-150	28	398	16	395
QMW25899.1|GT32	1.28e-148	32	398	47	413

PDB Hits     

TSTA_092930-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.32e-22	88	389	101	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.95e-22	88	390	98	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	6.87e-20	90	389	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	5.21e-17	90	341	134	352	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|O14084|IMT1_SCHPO	2.09e-07	114	178	98	159	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000006

TMHMM  Annotations     

Start	End
9	28