CAZyme Information: TSTA_086360-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_086360-t26_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: UDP-glucose,sterol transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1201	EQ962653|CGC7	131315.38	7.3200

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:1617436-1621369(-)

Full Sequence      

MALPHPSGGHTGRAASYDLSQIPTHEDFSVGEEIPMPVYSKVYGRMDLANEGLKTQASIN
DEGRVNIDIDEPTSRLRAMFKLPTFGTRSRATTVTAPILPSRDRPRDQNPPPLNIVIQVV
GSRGDVQPFIALGRVLKFHHGHRVRLATHESFQGFVEENGLEFFNIGGDPMELMAFMVKN
PGLMPGFDALKNGDIRRRRMEIASIISGCWRSCFEAGDGTGMPVSDRNTDLKNFHGGNVP
FVADAIIANPPSFAHVHCAEKLGIPLHIMFTMPWSPTQAFPHPLASINRSNADAGITNYV
SYAIVEMMTWQGLGDIINRFREKSLGLAPISLMWAPSMIARLKIPHTYCWSPALIPKPND
WGNHIDIAGFYFLSLASNYTPSVDLAAFLDAGPPPIYIGFGSIVVDDPNHMTQLIFDAVR
LTGQRALVSKGWGGLGTEQLGVPEGVFMLGNCPHDWLFHRVSCVVHHGGAGTTAAGIAAG
RSTVIVPFFGDQPFWGAMVAKAGAGPQPIPYKQLTAEKLADAIKFALEPATSEKAASLAA
KIEAEHGSEDGAISFQNHLNVEKMRCSLDPDRTAVFRIKRTQVRLSALAFAVLNVEGKLG
LDDVKLYRSKEYMTEADPTDPVIGGGAAMLDSIEEFLMGFADLSIDVKRSLNTRIARSRS
QSPASVSRKSASQSPAGSPTTAARAKILSDDDSVKNLTEISTVSTKGSTSRPLSGDLHSS
TVPTTDRLFDDSTRVETQSVNSLPLPKETRTRKHARTINDIHDIDLDGIVSAGKSAAKLV
NVGLRAPASFTMAVAKGFHNAPLLYGDDTVREQPKVTGIKSGFKAAGKEFGYGFYDGISG
LATQPVQGVIKEGPVGAIKGITKGIGGLIFKPAAAVWSLTGYPMSGIYKEIQKRFGESVE
NYIMASRCAQGLADLSNCTTEEKENILMNWSYYEADIVAKRNARRNRKKSNGTGKRARSG
TIGDRSKDGENTASERDTESVKAAERANRRQSLRQLFRGRSNSSPPPRTSTPDSALPDEY
EHAIRHSVLATSQRNDTEDEMIERALRASMTELRDAKADGEEEERAYSLAVEASIREAER
VIEEKKREREARGTVSEVEKSNHIHAPESQPRSKSADEAGKEQRKYPPKLPPRSSVSADH
DAEMENALKESKKSYEDDLRREKEEMDILVEYVKRQSLAEAEQQKQQQKPADVQQEKAME
S

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	241	552	5.2e-57	0.7329842931937173

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.27e-70	113	558	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.76e-25	115	548	4	387	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.17e-16	115	281	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
173412	PTZ00121	1.87e-07	928	1201	1072	1341	MAEBL; Provisional
173412	PTZ00121	9.77e-06	939	1177	1488	1739	MAEBL; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA15144.1|GT1	0.0	1	1189	1	1194
QKX62129.1|GT1	0.0	1	1186	1	1175
ATZ49754.1|GT1	0.0	1	1180	53	1286
CCD33816.1|GT1	0.0	1	1180	53	1286
APA09867.1|GT1	0.0	35	1060	81	1155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	8.08e-73	120	597	27	474	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.36e-72	120	597	47	494	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.33e-30	259	545	113	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.28e-28	113	545	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	9.96e-18	259	542	114	383	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	7.73e-125	111	562	154	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	4.01e-124	111	570	191	620	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	1.83e-70	91	555	1151	1604	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q6C8M8|ATG26_YARLI	3.13e-70	96	554	982	1404	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q0CKU4|ATG26_ASPTN	8.56e-70	113	554	898	1306	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000009

TMHMM  Annotations     

There is no transmembrane helices in TSTA_086360-t26_1-p1.