CAZyme Information: TSTA_084680-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_084680-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
921	EQ962653|CGC5	103948.47	6.2439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:1171584-1174741(-)

Full Sequence      

MPSLFPSRWSFRGNKTSKEDGTPEESTSQRDSLPVSEAGRSIRGQSYFDRRYTNNGIDDV
AKYKAMIKFFHVRLTAYQWLPSPIHPQHSSTGVFLRRSRGVYMSEPEDVNPVLVAAIQRI
NATVAFTMTTETTSIITSQLAPGQTELILPNGYQVQIIESYADIAGSHSNMVKKYQYCAL
IREEHLLLVWNDDLNAILSHAADVEAKLLSLIWGSPVPTFNLQLTPLATPGESVVASPND
SSYHLALETPRESQPAAEDSGTSRDTSPRRMLNEELKHPKESLERPLAVTSAIFVGMAVM
LLVILLLGFGISNLLLEYSVDGGAMRFALTATIPFFLLFSIFFMIVIFTDIFQAVGPIKT
LKTNTRFYSPIAPDLKTAYSLGFTPPRVTIQMPIYTESLEGVIKPTIKSLKTAISHYESH
GGTANIFINDDGFALLSEEEKRERIDFYHDNNIGWVARPKNNEGDYIRKGKFKKASNMNF
ALNVSNKVEEELIRRMAPKLEKSDMVDPMEEELVYREAFDHVIQSDPRIRGAGGDIRVGE
FILIVDSDTRVPADCLLYGAAEMFLSPEVAIIQHSTSVMQVSRDYFENGITYFTNLIYSA
IRFAVGSGETAPFVGHNAFLRWQAVQSVGRPDDGYVSFWSESHVSEDFDIALRLQIQGNI
IRLASYHNDEFKEGVSLTIYDELSRWEKYAYGCNELVFNPIHTWFYRGPLTKLFMTFLWS
NLQLSSKITILGYISSYYALASGFPLTVLNYFLVGWFEGYLDKFYMESWKVFLSLLVVFS
AAGNVCLAVIRYRLGEKSLLSSLVENFMWMPMFAIFFGGLSFHLSLAILAHMFRINMSWG
TTAKEKDDSNFFKEMPKIFKSFKWMYAVVIPFFPAMIYLACFAPHGWTITEVGAIVPMSV
TLASHALLPLLLNPSLMVFNY

Enzyme Prediction     

No EC number prediction in TSTA_084680-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	542	753	4.5e-56	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.37e-53	541	754	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	2.10e-11	390	647	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	5.20e-11	539	845	138	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
224137	GT2	1.23e-04	511	733	47	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
133034	Glucan_BSP_MdoH	3.04e-04	540	624	97	182	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18667.1|GT0	0.0	1	921	1	919
CAE7220538.1|GT0	0.0	57	921	53	907
QRD03074.1|GT0	0.0	57	921	3	858
CBX97842.1|GT0	0.0	11	921	9	904
UNI18966.1|GT0	0.0	44	921	33	905

PDB Hits     

TSTA_084680-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TSTA_084680-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000026

TMHMM  Annotations     

Start	End
293	315
327	349
735	757
770	792
807	829
867	889
894	916