CAZyme Information: TSTA_084670-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_084670-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1565		166581.72	4.2227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:1165632-1170617(-)

Full Sequence      

MTAEWLLFLTAAGSILGSASGLPTWPSSVDELEDIMFLNTGYQARAFPADITPCSFSPDG
PSRISSAEWLRTAFHDMAPGNAFTGVGGLDASLQYELGGDGGENIGTAFNNTLLSFTPFF
SSRASLADLIALGVYTSVRVCGGPTIPIRTGRIDATAAGPIGVPLPQNSQYTFIQQFSRM
GFNVSEMIALTACGHTIGGVHASNFPEVVQSGTVPNDYQHFDSTTKFDEKIASEYIGGNT
SDPLAGPLAIKNTYDSDMAVFTADNSTIRLMADPEYFQSRCQVMLQRMIEVVPAGVALTD
PIAPYEVKPSNLQLTIQPGGTQLQFTGEIRVRTTNLSGDISNVQLVYVDRDGASTCGSCV
IGTQYAGTANGFDDSFVFYSFSATLPAKASISSFTVQVTAGGNTVTHNNNGNGYPVQDNI
LFQNPQSCIAGSTDSNGNTKMTVTAAVRNTVTSGTSTLSVEVKTPRSCCVVPGLSTVNVT
MAKTGTIGEYDLYRGSYALTPKQITTSKFSVSIGKFSDSFKSTALTGSCSELSGSSPVAY
SYLGCYTDDVNSRTFPAATTSDNNMTLTECSNFCSGYPYFGTEYTTQCFCGSSLSNSTTE
AAETDCNMLCGGDSTESCGGPSRLSVYTNNKYVIPGGTTIPGYQYLGCYNDTAAARSLSG
TYTYNSKMTVESCATFCNGATYFGVEYYSECYCGDTLAADSTKQSVTDCSFPCSGNSSEF
CGGGNRMNLYQLGSTIVTTSSDPVSSSTTPTTVASLPTTVTILTTTSTAASSSTSSTIVS
SSSSTTVSTSAMLTSDPPPSSTSVPASLSATFSTTGSTSATTTSDTTTATGLPAGWAYRG
CYVDNIGGVRSMLVQENDNSTMTIESCISQCISLDYTVAGMEYSQQCFCDNYVRNNASLA
TSDSQCAMTCAGSTNEICGGPNLLSVYSNAEITVLPPPTAQTTDLPGSWVYKGCLQDNVN
NTRTFPYMITYANNNSATACLSRCQEYGFQAAGMEYGEQCFCGDTFDIGPDVQIVPDSQC
NILCTGDTFHYCGAGNLLSYYVWEGDTPLYDWTYASGNDAGLYQFLIGGVVVPLMTTVNI
NGKVTFLEKWGTGPPNTTGAYELDLFYETDFDKAWRPMHVKTDIFCSAGLVLPDKAGRQL
TVGGWSGVSTEGIRLYWPDGSPGNPGINDWQENQNELTLQDGRWYPSGMIMANGSILIVG
GETGSNGPPVPTLEILPKVGPTLYMDWLQRTDPNNLYPFMGVLPSKTILAAYYNEARLLD
EATFQTVRTLPNMPGAVNNDLGGRTYPLEGTMVFFPQYAPYTDPVRVLICGGSTPYGGDA
IDNCLSIQPDVPGQNWTIERMPSKRVMTCITPLPDGTFLILNGAHQGVAGFGLATSPNLN
AVLYDPTKPVNKRMTVMANTTIARLYHSESVLLPDGRVLVSGSDPEDGTHPQEYRVEVFI
PPYILSGAPRPAYTITETDWAYGGTYIITVTAGNIANLKVSLIGLISTTHGNSFGHRTFF
PAFTCQGNQCTITAPPDPWTSPPGWFHLFILDGPTPSHSSFVRIGGDPGELGNWPDLPDF
NVPGV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	1058	1559	3.8e-154	0.3747072599531616
AA2	66	226	5.3e-22	0.6196078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	2.46e-122	25	290	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
399910	Glyoxal_oxid_N	2.29e-25	1116	1312	59	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
396406	WSC	2.42e-25	543	620	1	80	WSC domain. This domain may be involved in carbohydrate binding.
396406	WSC	4.02e-25	646	723	1	80	WSC domain. This domain may be involved in carbohydrate binding.
173823	plant_peroxidase_like	1.73e-24	67	277	19	242	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18666.1|AA5_1	0.0	1	1565	1	1706
ATZ53635.1|AA5_1	0.0	537	1565	146	1118
QSZ36764.1|AA5_1	0.0	540	1565	81	1052
APA11718.1|AA5_1	0.0	540	1565	140	1109
UNI14602.1|AA5_1	0.0	543	1565	154	1124

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LXZ_B	8.64e-17	1353	1544	413	603	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	8.75e-17	1353	1544	418	608	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
4UNM_A	8.89e-17	1353	1544	424	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
1T2X_A	1.08e-12	1121	1544	223	637	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2EID_A	1.08e-12	1121	1544	223	637	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF1|WSCD1_ARTBC	0.0	643	1565	63	924	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|D4AUF4|WSCD2_ARTBC	3.57e-262	1	730	5	715	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	6.93e-54	1096	1544	121	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	4.17e-51	1061	1544	15	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.38e-44	1116	1544	169	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999685	CS pos: 21-22. Pr: 0.9587

TMHMM  Annotations     

There is no transmembrane helices in TSTA_084670-t26_1-p1.