CAZyme Information: TSTA_080970-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_080970-t26_1-p1
• CAZy Family: GH35
• CAZyme Description: endoglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	EQ962653|CGC23	49321.10	4.2793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962653:91279-92745(+)

Full Sequence      

MATKVLGFAAIAALFHKVTCQQAPTPDNIASLLTWKCTNSGGCIQQSTSIVVDWVYHWIH
TVNGSTSCTTSSGLDSNLCGSEQECYANCEISPATYDSLGIKTSGNALTLNQYVTSNDNA
GKNYEMLQLLSQEISFDVDVSNLPCGENGALYLSEMDVTGGRSQYNPAGASYGSGYCDAQ
CGTGTWFNGSINSGGLGSCCNEMDLWEANSKATALTPHPCSVEGPYGCSGSACGSTGVCD
KNGCGFNPYALGDQSYYGQGFIVDTSKPFTVTTQFVTSDNSKTGTLTEIRRSYVQNGKVI
ANAVASASSGFSGANSITESFCTTMDSEAGTLGGLNTMGEALSRGMVLIFSIWNDAGGYM
NWLDSGNSGPCSSTAGIPSTIEANDPGTSVTFSNIKWGDIGSTVSDTGGSGSSSSSLIST
KTSSTTTTSATRTATSSGATQTHYGQCGGMYYTGPTVCASPYTCHVQNQYYSQCL

Enzyme Prediction     

EC	3.2.1.4:18	3.2.1.73:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	26	404	1.1e-138	0.980722891566265

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	25	403	5	434	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	1.20e-169	26	398	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
197593	fCBD	4.98e-11	442	475	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.47e-10	443	471	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEG74551.1|CBM1|GH7	2.81e-287	1	475	1	495
GAM37432.1|CBM1|GH7|3.2.1.4	1.62e-286	1	475	1	495
QGA21666.1|CBM1|GH7	2.37e-284	1	475	4	497
AEL78899.1|CBM1|GH7	7.36e-276	1	475	1	495
ALE19913.1|CBM1|GH7	5.57e-191	9	475	9	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SU8_A	3.07e-171	21	403	2	394	Chain A, Glucanase [Rasamsonia emersonii],6SU8_B Chain B, Glucanase [Rasamsonia emersonii],6SU8_C Chain C, Glucanase [Rasamsonia emersonii]
5W0A_A	3.98e-133	25	409	7	373	Crystal structure of Trichoderma harzianum endoglucanase I [Trichoderma harzianum],5W0A_B Crystal structure of Trichoderma harzianum endoglucanase I [Trichoderma harzianum]
1EG1_A	1.11e-129	25	403	7	370	Chain A, ENDOGLUCANASE I [Trichoderma reesei],1EG1_C Chain C, ENDOGLUCANASE I [Trichoderma reesei]
1GPI_A	1.61e-120	25	407	7	430	Chain A, EXOGLUCANASE I [Phanerodontia chrysosporium],1H46_X Chain X, EXOGLUCANASE I [Phanerodontia chrysosporium],1Z3T_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3V_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3W_A Chain A, cellulase [Phanerodontia chrysosporium]
2XSP_A	1.62e-111	25	403	7	437	Structure of Cellobiohydrolase 1 (Cel7A) from Heterobasidion annosum [Heterobasidion annosum],2YG1_A APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum],2YG1_B APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QCS4|CEL7A_MYCTT	6.06e-157	7	475	8	464	Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=eg7A PE=1 SV=1
sp|A1CG87|CELB_ASPCL	1.01e-151	13	403	11	411	Probable endo-beta-1,4-glucanase celB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=celB PE=3 SV=1
sp|Q0CC84|CELB_ASPTN	5.02e-150	25	403	24	414	Probable endo-beta-1,4-glucanase celB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=celB PE=3 SV=1
sp|Q2TX26|CELB_ASPOR	4.95e-144	9	403	6	413	Endo-beta-1,4-glucanase celB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=celB PE=1 SV=1
sp|B8NW70|CELB_ASPFN	4.95e-144	9	403	6	413	Probable endo-beta-1,4-glucanase celB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999769	CS pos: 20-21. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in TSTA_080970-t26_1-p1.