CAZyme Information: TSTA_070780-t26_2-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_070780-t26_2-p1
• CAZy Family: GH3
• CAZyme Description: N-glycosyl-transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		39189.01	5.0582

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962652:3122727-3123917(+)

Full Sequence      

MHMTINEMNEWNAHLQTPVNFNHHEPIDVNATSISFVDLNPIKTTPKAASNGERVLILTP
LRDAAPFLQKYFDLLVQLTYPHDLIDLAFLVGDSTDDTLGVLSKELDRVQNQAEQKVAFH
SATIVQKDFGSDIDMDIKEKHSFEAQGPRRKAIARARNFLLYSALKPEHSWVYWRDVDIV
DSPDKILEDFMAHDKDILVPNIWFHRYDADGHDIEGKFDYNSWIESDKGRRLAESLPKDT
ILAEGYKEYDTGRTYLVKLGDWRNNKDEEVELDGVGGVNILVKADVHRAGINFPAYAFEN
QAETEGFAKMAKRAGYQVVGLPNYVVWHIDTEEKPGNLGGRKAY

Enzyme Prediction     

No EC number prediction in TSTA_070780-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	32	296	1.3e-108	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	7.88e-161	33	297	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13607.1|GT62	6.67e-238	1	344	69	411
QKX56390.1|GT62	9.19e-229	1	344	69	411
CAP99070.1|GT62	9.28e-213	1	344	69	412
QQK44843.1|GT62	8.84e-211	1	344	69	412
BCR85123.1|GT62	3.24e-209	1	338	69	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	4.27e-70	34	332	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	5.55e-98	21	329	49	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	9.14e-97	50	329	95	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	3.65e-78	28	329	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	4.00e-77	32	329	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	2.78e-71	28	328	67	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_070780-t26_2-p1.