CAZyme Information: TSTA_065170-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_065170-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: exo-polygalacturonase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		46299.57	4.5555

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962652:1584966-1586279(-)

Full Sequence      

MRILTLRSLLLAPVALGYVVNEGTTYQIYPEALTHNGQAVDDAPSIHQAFDLCGINGTVI
FTNNTFHINSILNTTNLLNCNVSLRGELRFSTNTPYWKSHVYSVIYQNQSTAWLFGGINT
WYTENKNQANQPGRPISITFYNSTNLLADGLTIFQPQFWATLVWQSTNVSLRNFYVNATS
NDEWGTVNTDGYDSWRSSNLLVESATIINGDDCVAAKGNTTNLLVRHVTCHGSAGMTIGS
IGQYPEWPDYVENVTFDGVRCINSSTGAYIKTWQGIPVDQDSNGDVGGGGLGLVKNVTFK
NFEMINTSLPIQISQCMYSESSGACNTSKLQIEDVSWVNITGTSRYNVVASLYCSDPVPC
PGIIFDNVTFESVNHTLGLPMWNTTMQDEVYQCANIDGQNSSGIPCNRVAPDSFGGVSHN
VQ

Enzyme Prediction     

No EC number prediction in TSTA_065170-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	62	399	4.2e-57	0.9384615384615385

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177865	PLN02218	1.78e-29	41	368	82	406	polygalacturonase ADPG
215426	PLN02793	1.71e-27	121	374	161	398	Probable polygalacturonase
395231	Glyco_hydro_28	1.38e-26	122	382	70	310	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	5.65e-26	135	371	155	375	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	7.39e-22	134	414	137	396	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX63102.1|GH28	9.09e-245	1	422	1	440
QKX53026.1|GH28	6.44e-231	8	414	9	431
QKX64775.1|GH28	6.45e-208	6	422	5	440
QKX64350.1|GH28	1.19e-195	1	422	1	439
QMW45518.1|GH28	2.17e-189	18	414	16	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.73e-35	39	360	28	351	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1NHC_A	1.29e-14	165	343	129	291	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
1HG8_A	2.02e-13	177	343	154	304	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1IA5_A	4.52e-13	134	356	103	313	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	8.09e-70	1	398	6	409	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	1.99e-65	8	407	14	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	1.99e-65	23	407	29	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|A2RAY7|RGXC_ASPNC	1.70e-57	36	368	35	393	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1
sp|B8NJB0|RGXA_ASPFN	9.13e-57	37	371	37	413	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000430	0.999545	CS pos: 17-18. Pr: 0.9727

TMHMM  Annotations     

There is no transmembrane helices in TSTA_065170-t26_1-p1.