CAZyme Information: TSTA_062890-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_062890-t26_1-p1
• CAZy Family: GH29
• CAZyme Description: cellulase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	EQ962652|CGC4	45993.43	4.3801

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962652:1001945-1003333(-)

Full Sequence      

MFGLKSLIAGLLLSPLQTLAQLHTSSRWILDADNNRVKLRCINWAGHIDLRIPEGLNKQP
IDTITTWIADNGFNCVRLTYSIDMALDPEQSVSDSFTAAGTAWDVQSEMTDAYNAAVARN
PFLSGASTLDTFAIVIDSLESKGVMTILDNHVSKASWCCNLTDGNGWWDTASGYIASNSR
YFNTTEWLAGLDAMATFARSHPGVVGMSIRNELRPFPLLQDLTHSDWYNYVTQGALTVHN
ANPDVLIIIGGSQSATDLSFIRNSNLDFSQWAGKHVWEFHAYSFTVTFPGNTDCMVASAE
YGLFDGFLLTQDKSYTAPLLLSEFGVGQSGGSNSGLSDSDYNYLQCLVQYMESNDAEWSV
WAVQGSYYIRDGTVDYDETWGLLNHEWSGWRNGNFSGLLVVLTLTVLVHPMLNKPT

Enzyme Prediction     

No EC number prediction in TSTA_062890-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	363	2.9e-115	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.08e-10	57	362	22	267	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14302.1|GH5_11	8.69e-273	1	399	1	399
QKX58257.1|GH5_11	4.34e-231	13	399	11	397
AEO57401.1|GH5_11	1.62e-174	4	399	5	417
AEO69593.1|GH5_11	5.14e-174	12	399	13	410
CDP32623.1|GH5_11	3.40e-163	22	395	39	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	3.14e-16	23	388	7	337	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	3.14e-16	23	388	7	337	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
4TUF_A	8.65e-07	25	391	5	333	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	3.40e-80	4	395	14	387	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	3.69e-15	23	388	48	378	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	2.01e-11	22	398	630	1008	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P19487|GUNA_XANCP	5.92e-06	25	391	30	358	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999714	CS pos: 20-21. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in TSTA_062890-t26_1-p1.