CAZyme Information: TSTA_059400-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_059400-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: BNR/Asp-box repeat domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	EQ962659|CGC12	40935.06	7.1048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962659:2008676-2009825(-)

Full Sequence      

MGIGQKILRRLGVSSDSTPPPVPPHPNPPVWNTQSQASLIINPDERDISTDRFNGTYIRL
ARLANGTILAGFTWREGGRMDALRILKISRSLDGGQSFHDFSEVYRGHGEIDNLHICEIS
PDGHILAAFRNHDFGHNRAGDLAGITHFRITVFESKDAGATWHYLSEAAEKSDPPLGIWE
PFIRMGVQGERTMQVTSYNRANLVPTTLHRGIPRQIRDGMTGITQTIDAATGQIALVMVF
ETTRYAPHFNVEAVVSYDDGYTWHHRHQVYTPRRRGHNAGAPQITSFGDGSLAAVFMTDD
DSAEVKWIHNAAIKICFAGPPCNGRIVWSEPVEVSPASSFWPGIMALDQRTALVTYEHEG
PRGRTVVRP

Enzyme Prediction     

No EC number prediction in TSTA_059400-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	55	311	8.5e-44	0.8925081433224755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	2.04e-06	62	303	152	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	0.006	48	164	192	295	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	0.006	60	302	19	222	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21784.1|GH93	3.37e-218	1	369	1	396
CAP92687.1|GH93	9.33e-114	4	366	6	358
QQK46347.1|GH93	3.14e-112	4	366	6	359
QKX55087.1|GH93	1.46e-111	5	366	6	374
QOW41364.1|GH93	2.59e-108	4	366	6	358

PDB Hits     

TSTA_059400-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TSTA_059400-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999949	0.000083

TMHMM  Annotations     

There is no transmembrane helices in TSTA_059400-t26_1-p1.