CAZyme Information: TSTA_056580-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_056580-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37258.47	5.2203

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962659:1222072-1223141(-)

Full Sequence      

MASMSDLKLDYIEGKSGDEVSDRALPPPASHNTQRTGNIGSWRSHLNAIRAVVENNLDSA
LILEDDADWDVRIHDQMYDYAETVRVLTTPLAGTTNSYADPSYYDPSKGGQPEELIFGQL
PKTVKPQVSPYGDDWDVLWIGHCGTEAPNINLADEEKAKKSHTIPRGRVIHYNDETVPQN
HHLHVMEQERDPREIFPDHTRTTHHVMGQICSLVYAVSQRGARRILYEMGVKKFDGPYDI
MLRDICEGVNDRPKGAVCLSVEPGIFNHHRPVGPSAYHSDISEHLAPPVEVAFTENIRYS
ARLALENYAVGSTELVDQWPDKIITSSSSSYAS

Enzyme Prediction     

No EC number prediction in TSTA_056580-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	14	241	5.7e-18	0.8011049723756906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	3.19e-12	1	70	18	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14382.1|GT25	1.23e-225	1	333	76	409
QKX58131.1|GT25	9.87e-192	1	321	79	399
AEO55058.1|GT25	4.68e-94	2	321	84	397
QLI69289.1|GT25	2.51e-90	2	321	126	438
AEO68754.1|GT25	3.17e-90	2	319	77	390

PDB Hits     

TSTA_056580-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TSTA_056580-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_056580-t26_1-p1.