CAZyme Information: TSTA_056020-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_056020-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
117		13092.83	8.3904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962659:1086980-1087383(-)

Full Sequence      

MRSLITLLPVFFLPVLGSPITEGFSKRDDRGSKTVTGISAHKEAILDAGGNTLDLAIAML
EIKTMNTADYSYSDGKTYDAANFSMFKQNWGILRERAYRYGFKGQSQDEWDNSARLK

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH134	31	116	3.1e-32	0.5157232704402516

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381622	mannanase_GH134	8.99e-34	28	116	1	86	glycosyl hydrolase family 134 inverting endo-beta-1,4-mannanase. glycosyl hydrolase family 134 beta-mannanase (E.C. 3.2.1.78) differs from other mannanases in as it has a hen egg white lysozyme fold and cleaves beta-1,4-mannans with inversion of sterochemistry. Beta-mannosidases are enzymes involved in seed germination and the degradation of the hemicellulose fraction of soft- and hardwoods.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
GAM40719.1|GH134	4.57e-55	1	116	1	116
CRG90978.1|GH134	4.69e-50	10	116	10	116
KOC17749.1|GH134	7.49e-43	10	114	11	120
QMW34277.1|GH134	7.49e-43	10	114	11	120
UDD63193.1|GH134	7.49e-43	10	114	11	120

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XTJ_A	1.05e-25	29	116	2	86	Mannanase(RmMan134A) [Rhizopus microsporus],5XTJ_B Mannanase(RmMan134A) [Rhizopus microsporus],5XTT_A Crystal structure of RmMan134A-M3 complex [Rhizopus microsporus],5XTT_B Crystal structure of RmMan134A-M3 complex [Rhizopus microsporus],5XU5_A Complex structure of RmMan134A-M4 [Rhizopus microsporus],5XU5_B Complex structure of RmMan134A-M4 [Rhizopus microsporus],5XUG_A Complex structure(RmMan134A-M5). [Rhizopus microsporus],5XUG_B Complex structure(RmMan134A-M5). [Rhizopus microsporus],5XUL_A Complex structure (RmMan134A-M6). [Rhizopus microsporus],5XUL_B Complex structure (RmMan134A-M6). [Rhizopus microsporus]
5XXA_A	1.68e-24	29	116	2	86	beta-1,4-mannanase-SeMet-RmMan134A [Rhizopus microsporus],5XXA_B beta-1,4-mannanase-SeMet-RmMan134A [Rhizopus microsporus]
5JU9_A	1.10e-20	31	116	10	92	Structure of a beta-1,4-mannanase, SsGH134, in complex with Man3. [Streptomyces sp. NRRL B-24361]
5JTS_A	1.23e-20	31	116	15	97	Structure of a beta-1,4-mannanase, SsGH134. [Streptomyces sp.]
5JUG_A	3.08e-20	31	116	10	92	Structure of an inactive (E45Q) variant of a beta-1,4-mannanase, SsGH134, in complex with Man5 [Streptomyces sp. NRRL B-16215]

Swiss-Prot Hits     

TSTA_056020-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000748	0.999226	CS pos: 27-28. Pr: 0.5242

TMHMM  Annotations     

There is no transmembrane helices in TSTA_056020-t26_1-p1.