CAZyme Information: TSTA_055270-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_055270-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: endo-1,3(4)-beta-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		47163.51	5.9244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962659:893268-894729(+)

Full Sequence      

MLVAEIAAFHVRPVAILRVKTADEALQFFANYNVLYAITMQYYLTFFVLITLTTVSAARS
VQTPFSTDSSTEKRGPPCDCYSVSGPDAGYFQHHRFWDFRQVPLNLLAAKDFKFQPITQA
DASTATENNDINAAPILLKDTPFAAEWLIQDWQRSGSQLFPIPIANSNQNAFLTRSLAGG
TSFLAMRTKRFERYSSTAEIETNISNFMHVSFRVRLRILGNDEPILSPPLIENKAFGKRN
DEMADMRIQEDPRFQRIAARLPPSTGACVGIFTFFSRTSESDIEILTSDPPNRAHYANQP
DYDPIRNIVIPGSQVAVDAHVPWTQWSTYRLDWLPGMSRWYVEDRLQASLAYGVPVDPSR
LIVNIWSDGGLWSGNLTVGNSVHLGIEWIEIAYNLTGEAPRPCNVVCRIDGVKTPGVPEM

Enzyme Prediction     

No EC number prediction in TSTA_055270-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	146	391	5e-82	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	9.99e-44	141	391	7	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.43e-04	326	389	140	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14506.1|GH16_22	2.96e-241	40	420	1	386
QKX57994.1|GH16_22	5.13e-174	55	420	20	385
QMW33413.1|GH16_22	1.54e-89	64	399	20	338
QMW45451.1|GH16_22	1.54e-89	64	399	20	338
UDD61087.1|GH16_22	1.54e-89	64	399	20	338

PDB Hits     

TSTA_055270-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45797|GUB_PAEPO	1.68e-07	324	394	166	238	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998808	0.001221

TMHMM  Annotations     

Start	End
28	50