CAZyme Information: TSTA_054640-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_054640-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	EQ962659|CGC4	84964.73	4.6731

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962659:705637-708538(+)

Full Sequence      

MAKMPNMAIISLCVLLTLGTAWANSPPPYKNPRLPVEQRVADLLGRMTIEDKMAQLMQGD
ITNWMNQTTGTFNSSGLVANMEEKAGSFYVGYPISWEWLTSNIQKGQDYLVHNTTLGIPA
LVQTEGIHGFLIGNATIFNSPIGYGSSWNRDLVRKMGQIIGQEARALGVTQLFAPLADLA
RELRYGRVEETNSEDPYLAGEIAYGYVKGLQSQNVSATVKHYLAYSNPEQGLNTGPVHGG
QRELRTTWAPPFKRAIIDAGAWSIMSAYHSYDGIPAVADYQTLTTLLRDEWGYDYWVTSD
AGATDRLCTAFRLCQASPIDSEAVTLAVLPAGNDVEMGGGSFNFKTIPQLVTSGKLNVST
VDTAVSRLLRAKFEMGLFENPYVGASADKWNELIHTPENVQVARELDRESIVLLENHNNT
LPLKKSGSIAVIGPMAHGYMNYGDYVVYQSQYRGVTPLDGIKSAVGDKATINYAQGCERW
SNDQSGFDEAIKAAKKSDVAIVVVGTWSRDQQELWQGFNATTGEHVDLNELGLVGAQAPL
VKAIADTGVPTVVVFSSGKPITETWISNSTAALVQQFYPSEEGGNALADVLFGDYNPSGK
LSVSFPRSVGTLPIYYDYLNSGRSIGDSGYITQNDTIVFGHQYVIGSPLPWYEFGYGKSY
STFKYGTVNLDKTNATATDIVIVSIDVTNEDISRNATEVIQVYVVDVYASVVVPNRQLKG
FEKVVFGPGETKTVLMSLDVSDLGLWNVNMQYVVEAGAFDVLVGSSSLDIRGNATFYVT

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	337	1e-62	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.36e-157	4	776	1	762	beta-glucosidase BglX.
224389	BglX	2.68e-78	47	478	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.31e-71	4	665	3	638	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.40e-61	411	660	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.56e-59	48	371	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14555.1|GH3	0.0	4	779	1	777
QKX60989.1|GH3	0.0	12	779	11	778
QMW32562.1|GH3	0.0	9	778	12	778
QMW44592.1|GH3	0.0	9	778	12	778
BAE62006.1|GH3|3.2.1.120	0.0	9	778	12	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EAP_A	0.0	24	778	2	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	0.0	24	778	2	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5TF0_A	2.59e-111	43	771	16	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	1.31e-109	30	771	5	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.56e-109	30	771	5	745	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH0|PLH24_FORAG	1.79e-125	68	767	16	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	7.32e-121	9	771	4	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.90e-115	10	771	7	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	7.36e-96	29	771	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	1.08e-92	116	770	35	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999787	CS pos: 23-24. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in TSTA_054640-t26_1-p1.