CAZyme Information: TSTA_051600-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_051600-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	EQ962657|CGC20	50936.49	5.8610

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962657:3009596-3010987(+)

Full Sequence      

MNSPSGNHLLADITTRRISRSARVSSWDQSGLNEDAFVVLPGETMLLADLEGPGAITHLW
FVQTCRQILGPGLIPYSKSGVAMMEIHNALGLNYEVNDPDYYRKVLIKMYWDDSETPNVL
APIGDFFCLGHSMAANFQSLPFTVSVKPSEEKKFGGAAAFNCYLTMPFNKRARIEIENQN
DEAYIQYFYIDYELYAKPLPKDTLYFHAHWRRENPTNGWAPSGIQTNSLETQVKNLDGKD
NYIILETEGAGHYIGCNHSVLHFQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFSQGWG
MQKNAYPFCGTIIHEEDVPNYQVSYRWHLADPVRFSKKIKVTLESGHANHLRDDWSTTAY
WYQTLPGPKLEILPVASRLPRKPEIIPPAPDLSELEISKLSLEKIEKLAQHRERYDMFVK
DRKEWLERRAKDSRERAMNNIKAVS

Enzyme Prediction     

No EC number prediction in TSTA_051600-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	102	363	2.7e-81	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	1.94e-117	103	363	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59927.1|GH172	0.0	1	441	1	441
CAK39208.1|GH172	3.89e-290	4	441	2	438
CAP93243.1|GH172	2.06e-288	4	441	2	438
UPK94269.1|GH172	1.52e-279	2	441	4	442
QKD59092.1|GH172	7.33e-274	9	441	12	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	4.02e-162	9	385	7	385	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	1.61e-54	20	363	20	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

TSTA_051600-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_051600-t26_1-p1.