CAZyme Information: TSTA_051180-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_051180-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: esterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300	EQ962657|CGC12	32098.93	4.7819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962657:2890392-2891315(+)

Full Sequence      

MTVMGEQSSPSSVSSGCGKTLTLHSGTYTTTVNGQQRQYTLTLPQGYNPSEPYKLIFGYH
WLGGTMQDVVSGSYYGIQPLAGNSAVFVAPQGLNNGWGNSGGEDITFTDQMLSTLEDALC
IDKTQVYSMGWSYGGAMSYALACARPNVFRAVAVMSGANLSGCSPGTQPVAYYAQHGVSD
SVLPFTLGEQIRDTFVKDNACTATNPPAPAAGSGTHIKTEYSGCSSGHPVWWVAFDGPHE
PLATDAGASSSWTPGQIWSFFSQFSLFKYASEIFKEVLMGVERMENLGILAIWSLNTLYL

Enzyme Prediction     

No EC number prediction in TSTA_051180-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	158	1.9e-22	0.5859030837004405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	1.07e-16	24	263	34	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	3.11e-11	31	159	372	508	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	2.98e-07	34	184	171	330	Predicted peptidase [General function prediction only].
395257	Peptidase_S9	1.86e-05	77	153	7	93	Prolyl oligopeptidase family.
223669	MhpC	0.003	96	158	60	122	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXF48684.1|CBM1|CE0	1.49e-171	9	264	85	340
CAC85738.1|CBM1|CE0	4.69e-162	16	264	96	344
UKZ97189.1|CBM1|CE0	7.89e-109	7	263	41	295
UKZ53227.1|CBM1|CE0	2.06e-108	7	263	17	271
CCA72326.1|CBM1|CE0	2.34e-107	14	263	23	268

PDB Hits     

TSTA_051180-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7RWX8|FAED_NEUCR	8.76e-84	14	265	28	290	Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=faeD-3.544 PE=1 SV=1
sp|Q5B2G3|FAEC_EMENI	3.32e-76	14	261	24	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|Q0CDX2|FAEC_ASPTN	2.15e-74	14	262	24	268	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	2.04e-69	14	261	24	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|A1CC33|FAEC2_ASPCL	4.91e-68	14	261	26	269	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000031

TMHMM  Annotations     

There is no transmembrane helices in TSTA_051180-t26_1-p1.