CAZyme Information: TSTA_050770-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_050770-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: SUN domain protein (Uth1), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		44804.30	4.5145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962657:2797778-2799146(-)

Full Sequence      

MKLSATIAIAAAGTLAAAQGHRHAHHHAHKRDTVATSTVDEVVTVYQLDGTPVPVADVCQ
GIKNGEYKWADGNAPSGACATSTSTSPTVKAAEFIQTSTSVSTSTSSSSIVTTSAVPTTS
ATPTTSSTSTTPTTTPATSTTPSATPAPTSGSGGATGVDAPFPDGELDCDTFPSQYGAVP
LDYHNIGGWSGIQYPTFNSLATLVENIVTAVQGQSCTEGAFCSYQCPEGYLKSQWPSTQG
ATGQSVGGIRCSNGKLVRTNTNYDTLCIPGVPALSVKNTLSEMVCLCRTDYPGTESETLP
SCVNPGQTIQLANPDGNSYYEWEGKSTSAQYYINPAGFDETQACIWGSPDPNPIGNFAPM
NLGLGYKNGVTFASIFPNKPTTSEILQYNVRYDGVSTECAWDSNAKAYKGGASADGGCTV
SIPEGSSATLVLY

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	123	432	1.6e-89	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	3.63e-117	164	419	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19737.1|GH132	1.62e-216	1	433	1	425
QKX59760.1|GH132	9.64e-163	1	433	1	445
EAA58515.1|GH132	4.50e-111	30	433	31	410
EAL86926.1|GH132|3.2.1.-	5.26e-108	7	433	8	414
BCR94847.1|GH132	4.30e-104	7	433	8	425

PDB Hits     

TSTA_050770-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	9.35e-109	7	433	8	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	6.30e-92	154	433	170	448	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|P40472|SIM1_YEAST	2.64e-69	156	433	213	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|Q9UR09|PSU1_SCHPO	2.44e-68	162	433	162	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|Q59NP5|SUN41_CANAL	3.83e-67	162	433	161	417	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999689	CS pos: 31-32. Pr: 0.2171

TMHMM  Annotations     

There is no transmembrane helices in TSTA_050770-t26_1-p1.