CAZyme Information: TSTA_047750-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_047750-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: alpha-N-acetylglucosaminidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		84511.89	4.4306

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962657:1981029-1983417(-)

Full Sequence      

MQIFYFLSSFLAISSTVVASCTQPSASGIEALLQRRLPQHADKFEFGIVNATSLGENDVY
VVLSAENGSIRIEGSSLSALATGLHRYLSDVAHVDIYWFIGSRLDQIDGQFPKLNEPLTG
SSVVPYRYHFNTVTTSYTSAFWSWEDWELQLDWMALRGINLPLAWIGIERIFIEVFQDLG
LTDTEIADFLSGPAFLAWNHFGNIQGSWSGSLPYDWVDSQFDLQKKIVKRMTELGMTPIL
PAFPGFVPRAITRVLPDADVINGSAWEAFPTMYTNDTFMEPTDPHFTEIQKSFIAKQIEA
YGNVTTFYTLDQFNENNPSSGDLSYLRNVSQGTWKTLKAADSNAVWVMQGWLFTSNSAFW
TNDRIEAYLGGVAVDSDLLILDLASESSPQWQRTNSYYGKPWIWCEIHDYGGNMGFYGQV
MNITNNPIAALHNSSSLVGFGLSMEGQEGNEIVYDLLLDQAWNAAPIDTESYFHDWVTAR
YAGSRSIPSSVYSAWDILRTTVYNNTNLAANAVPKAIFELIPSTTGLLNRTGHHPTKLNY
NTADMVQAWNLFYTSAFKEPSLWLNPAFEFDLVDMSRQVLANAFIPVYENLISTYNTSNP
SSTKLQTIGAELIGILQALDTVLATNKNFKLSTWLSAARASAGSQHNIEDFLEYNARNQI
TLWGPTGQISDYASKSWAGLVSSYYIPRWKMFVEYLIDTPVAKYNQSAFNRGLLIWELQW
QNETIAAAVGEEKVGGSVESVLEGVVGQWKDVFSS

Enzyme Prediction     

No EC number prediction in TSTA_047750-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	67	726	6.7e-209	0.9683257918552036

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	127	464	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	1.24e-88	472	724	1	242	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	2.18e-24	27	105	1	75	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19502.1|GH89	0.0	1	755	1	768
QKX62920.1|GH89	0.0	11	754	8	754
QYS99001.1|GH89	0.0	19	753	18	745
UKZ51971.1|GH89	0.0	12	753	13	746
UKZ88341.1|GH89	0.0	18	753	17	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	2.47e-148	26	699	6	662	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	2.55e-97	42	694	188	822	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.97e-97	42	694	196	830	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.85e-96	42	694	211	845	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	3.50e-147	26	699	29	685	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	2.11e-134	13	724	35	781	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000786	0.999231	CS pos: 20-21. Pr: 0.9710

TMHMM  Annotations     

There is no transmembrane helices in TSTA_047750-t26_1-p1.