CAZyme Information: TSTA_046700-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_046700-t26_1-p1
• CAZy Family: GH15
• CAZyme Description: Melibiase subfamily, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	EQ962657|CGC21	77888.09	6.1417

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962657:1727265-1729400(+)

Full Sequence      

MAQPSSIVWQTSTLTVQLVVGSDEMVRIEQDPSSPKQGAVPLFGVRLNGDGNPSQKSAKA
LIGSYVSSRLKYQGHQEYGNDRVKSLDVTAFDETSQISVTAHLSVYSGIPVIRSTMTIHN
ESQKDIVVDQLSSFVVGALGGKPINCWLDYTLSTPTNTWFREAQWRDESLPNVGLDDIGL
SELPESHDASLAVHAVSNRGTFSTGTYLPLGLLKKYDSSETWLWQIETNGSWRWELGDFQ
ENVYLALGGPTNKDHGWKHCLAPSQSFTSVPVAICHVLGHPDSAFAALTEYRRRIRRPHK
DNDELAIIFNDYMNCLMGDPTTEKVMALVDPAVKAGAKFFVIDCGWYADDNGWWDDVGLW
EPSTKRFPGGLKALLDDIRAKGLIPGLWIEPEVIGVRSVVANMLPADAFFQENSRRIVEK
GRYQLDYRHPEVIKRMDKVIDNLVRNYGVGYFKFDYNIEVVQGTDASSFSPADGQLGHNR
AYLEWVGKLYDRFPDLIIESCSSGGQRMDYALLAIHSLQSTSDQQDPVRYSAIAAAVPTA
VTPEQSASWAYPQPKWDNEKNAMTVVNSLLGRVHLSGRIDLLSSQQLELVASGMQVYKQI
RSDLKTGLPFWPLGLPKWHDDWVALGIAASGGVRYVAVWRRSGSDTVSLHIPVLKDREVV
VKLLYPEIFETHAQWHSDSGALSVRVPSVACARLFRLSVN

Enzyme Prediction     

No EC number prediction in TSTA_046700-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	65	639	2.2e-100	0.815406976744186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	3.50e-90	304	599	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	4.59e-36	291	602	27	342	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	4.22e-26	194	607	178	592	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	2.04e-09	309	383	5	80	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
269878	GH31_NET37	2.21e-05	316	507	11	198	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28301.1|GH36	4.92e-307	41	699	51	707
UDD63863.1|GH36	5.26e-302	1	698	1	715
BAE64621.1|GH36	5.45e-302	1	698	1	715
EAA67014.1|GH36	5.91e-302	41	700	72	732
QMW46905.1|GH36	1.40e-301	1	698	58	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PHU_A	4.98e-28	81	607	142	648	SpAga wild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	2.04e-27	81	607	142	648	Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]
2XN0_A	1.91e-26	80	607	131	639	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	2.53e-26	80	607	131	639	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
3MI6_A	6.69e-23	80	573	128	587	Chain A, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	9.82e-26	80	607	131	639	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|P27756|AGAL_STRMU	1.20e-24	56	607	101	628	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
sp|B8NWY6|AGALC_ASPFN	2.25e-24	83	645	152	696	Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglC PE=3 SV=2
sp|Q2TW69|AGALC_ASPOR	2.25e-24	83	645	152	696	Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglC PE=3 SV=1
sp|Q5AU92|AGALC_EMENI	9.14e-24	65	552	120	592	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999951	0.000097

TMHMM  Annotations     

There is no transmembrane helices in TSTA_046700-t26_1-p1.