CAZyme Information: TSTA_042680-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_042680-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: glucan endo-1,3-alpha-glucosidase agn1 precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		46951.76	3.8900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962657:679786-681199(+)

Full Sequence      

MLSILVALLALTRLSAGKAVFAHYMVGSMTSSEASQDISNAIAAGFDGFALNTHTISSSD
TWNTDAINYLLNAAQGTNFKMFLSFDMSWNLDVASLGSFLLQFSSHSQYYTTDDGRPWVS
TYDGGSIDSATWDSSFIQPLVTGGVTPYFVPDFDDWSGFPQGFFDSFPVVDGAFSWESAW
PSAGSTAANVSDSVDESLIQQAHAAGKVYMMPLSTFQFKYLGSGQDWYRIGETNLPERMA
QILALQPDFVEVITWNDAGESHYVGSFWPEQIAGTNEDDYANGFDHTGWQKVIKPFITAF
KNGATEVSSMVSESGNPEGAIWYRTLLTSASCSSTITNYQQARDAINFAVILPSSSSPYT
IEVYSNNQLIGTFSGVEGLNYESVPGLQAGGGQYIQVLDSTGDIVASANGTKNVLSEGSD
SSMCNWNYEVVGLP

Enzyme Prediction     

No EC number prediction in TSTA_042680-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	20	401	2.9e-75	0.9786666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	1.65e-126	20	406	1	372	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	8.17e-98	15	303	2	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	2.18e-25	20	293	1	279	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19017.1|GH71	3.47e-252	25	433	1	410
QKX64108.1|GH71	3.03e-226	3	433	6	432
QGA18544.1|GH71	7.22e-197	17	433	193	606
QKX64730.1|GH71	1.91e-187	20	433	22	445
UKZ75687.1|GH71	2.97e-186	18	433	123	534

PDB Hits     

TSTA_042680-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	5.99e-52	7	385	13	380	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	8.33e-34	15	367	33	370	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	1.82e-33	10	419	3	418	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001793	0.998221	CS pos: 17-18. Pr: 0.9690

TMHMM  Annotations     

There is no transmembrane helices in TSTA_042680-t26_1-p1.