CAZyme Information: TSTA_041280-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_041280-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: pectin methylesterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	EQ962657|CGC11	34862.55	5.2472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962657:262093-263444(-)

Full Sequence      

MKTFILTLALAVSALAGSRMTPPAGSIVVAKSGGKYSTISAAIAALSTTSTSTQTIFIEQ
GTYNEQVYIPSLKGELVIYGQTEDTSSYSSNLVTITHGLSASQAGSDDLSATLRNYAAKS
RIYNINVKNTYGSGAQALALSAYATDQGYYGCQFIGYQDTVLAETGNQLYAKCYIEGAID
FIFGQHATAWFDGCDIGVVARNGNVGTITANGRSSSSDPSYYVINKSNIAAASGQSVSAG
SYYLGRPWSQYARVVFQYTSMSNVINSAGWEVWSSSQPNTQDVLFGEYDNSGAGSQGTRA
SFAKKLSSPIGISSILGADYTSWVDTSYLS

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	307	6.9e-80	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	1.18e-51	27	295	2	266	Pectinesterase.
215357	PLN02665	4.48e-47	27	307	70	341	pectinesterase family protein
178051	PLN02432	5.87e-47	13	308	1	274	putative pectinesterase
215367	PLN02682	2.61e-45	23	307	67	348	pectinesterase family protein
178372	PLN02773	1.54e-43	22	306	2	282	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARB08121.1|CE8	6.17e-167	2	330	8	331
QKX54343.1|CE8	1.83e-158	13	330	13	328
QMW43208.1|CE8	3.76e-142	2	330	3	331
CAK38387.1|CE8	1.53e-141	2	330	3	331
QMW31157.1|CE8	2.17e-141	2	330	3	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	7.02e-75	18	328	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.40e-74	18	328	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.08e-32	27	294	10	272	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.12e-25	28	294	6	268	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	3.30e-14	33	294	45	365	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.21e-141	2	328	3	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	5.15e-140	2	330	3	331	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.90e-77	18	328	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.90e-77	18	328	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	3.54e-75	18	328	28	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000421	0.999567	CS pos: 16-17. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in TSTA_041280-t26_1-p1.