CAZyme Information: TSTA_039680-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_039680-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase CSH1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		44049.49	9.0668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962654:4454217-4455474(-)

Full Sequence      

MSHLRIRPLAGILVLLCILYVLVSNIFNFSRIFSSPHSGISLSQSAIRTAYYNHTINRTH
EAVIPRKIHQIYHDWSGQGGNVPHTAQWMRLRDSCINRNPGWEYKLWSTAESREFLQREY
PWVLPIYDSYRYPVQRVDTLKYFIMRHYGGIYVDMDNGCLESLEPLRYYPAFVTDGIEGP
LFINILGAVPHHPFYEYLTNNLWTYNLFYYPLPYLTISYNSGRWFFTSMWEKYHDRVNWM
NWNLIHSAGEGADQIHASKINENQLYRVVMESRRGAEPWVFWNEGAGLTWQDWDYSMFSS
IGQDAAKIIRIATAVTISLSILTPLVIWRCCCRSRKAKHNTTGGLKTVAALLTPVLSPVL
GSREKRADYFIKKGHDIV

Enzyme Prediction     

No EC number prediction in TSTA_039680-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	88	167	3.7e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.91e-28	55	233	73	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.63e-17	88	172	4	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16047.1|GT32	1.30e-242	1	378	1	375
QKX60406.1|GT32	4.92e-148	4	368	3	350
QGA12364.1|GT32	1.78e-85	37	309	43	303
QBZ58620.1|GT32	1.31e-83	5	345	4	339
AEO56548.1|GT32	7.56e-80	23	302	24	297

PDB Hits     

TSTA_039680-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	1.23e-38	61	233	79	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	3.04e-38	52	239	45	227	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	3.33e-37	52	233	50	223	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	7.25e-36	63	233	54	216	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.94e-26	64	329	64	300	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999950	0.000087

TMHMM  Annotations     

Start	End
7	29
308	330