CAZyme Information: TSTA_039010-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_039010-t26_1-p1
• CAZy Family: GH11
• CAZyme Description: beta-galactosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1033		117360.78	5.6626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962654:4265202-4268362(+)

Full Sequence      

MSFPKSLPDWNNLKVIHKGTLLPRAHFYSYVSEKEALTLNRQQSEYVSLNGTWKFRHDES
PLEAPEWSSVDPLDWDDIKVPGMWQLQGYSHPTYTNVNYPFHVNPPHVPLLNETGSYWRQ
FVTPSVWEGQQIRIRFEGVDSAFHLWINGEQVGYSQGSRNPAEFDITSFLQPSGSANTIA
VRVYEFCDGSYLERQDQWLASGIFRDVGLLAFPSNAVIDFSAVATLSEDLLSGELAINVK
TQGEDGVLQTKLYGADGTLLNDSTFHSTESHRIQVLGEDLQLWSAEHPILYTLLLSFNGR
TIPQRIGFRRIEQKDSNFLVNGKRIILYGMNRHEHHHLYGRAVSYESMRADLVLMKKHNI
NALRCAHQPNDPRLYEVCDELGLYVIAEADLETHGFDPVERSNIQNQHLMSEYEIQETSY
KMAKKWTSDNPEWKEAYLDRAVELVQRFKNFTCIIFWSLGNEAFYGQNHAVMYKWIKETD
PTRLVHYEGDRDALTADLYSSMYWGIDALKAHIKEKTDKPLIQCEYGHAMGNGPGGLREY
IEAYRTEKLLQGGFIWEWCNHGLLKRDGDTTYYAYGGDFGDQPNDADFILDGMVFSDHTP
TPGLLEYKKVIEPVTVQLWGNQLEVKNHYDFSTLDHLTVSWHLVKETGNTEPNLWQLPEI
KPGDSQLVDLPNGVKMTTEPTWFTLNFCLKNATAWAPKGHEIAWAQIPLFQEQFLSIPSI
PVSPRSVLSICERAGKLHIASNTFGSRFTYDLIRGSLSWSSDMSKIFNSGPQLGIYRALT
QNDLGLEGPHVEWSRFRVESARMLIQSVTWRCNEDGTVNIDTNVRVAPTVLEWALEATLS
YTITESSIKIHVKGDFTGTYPKYIPRLGLTIRLPRRYDASTWFGRGPGESYRDKKSAARF
GTYTASLCDGLQTPYEWPQENGNRTDTLWARIHSSPLDTSYATSAGALAPLPGIEVGMNT
PFNFSLRQHSITELDRAKHPHELSDLVDETELNVDFAHHGIGTASCGPGPFDGHRLEAGP
FDFNVMFRLGDGI

Enzyme Prediction     

EC	3.2.1.23:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	36	900	2.5e-204	0.973404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236548	lacZ	0.0	9	1002	16	998	beta-galactosidase.
236673	ebgA	0.0	10	1023	4	993	cryptic beta-D-galactosidase subunit alpha; Reviewed
225789	LacZ	1.98e-142	44	902	10	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	6.49e-115	311	614	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
214988	Bgal_small_N	1.62e-66	745	1027	4	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16119.1|GH2	0.0	1	1031	1	1031
QYS98048.1|GH2	0.0	1	1029	1	1013
QKD57317.1|GH2	0.0	3	1031	2	1015
UPL02948.1|GH2	0.0	1	1031	1	1010
QMW30839.1|GH2	0.0	3	1029	9	1010

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	5.32e-217	12	1029	18	1029	Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6S6Z_A	8.86e-177	9	1033	3	985	Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	9.09e-177	9	1033	4	986	Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3MUY_1	9.60e-168	9	1027	15	1020	Chain 1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]
3MUZ_1	2.05e-167	9	1027	44	1049	E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MUZ_2 E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MUZ_3 E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MUZ_4 E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MV0_1 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV0_2 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV0_3 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV0_4 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV1_1 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12],3MV1_2 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12],3MV1_3 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12],3MV1_4 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00723|BGAL_KLULA	2.23e-216	12	1029	11	1022	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
sp|P06864|BGA2_ECOLI	6.41e-188	10	1029	4	997	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|Q56307|BGAL_THEMA	4.68e-176	9	1033	4	986	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|O52847|BGAL_PRIM3	1.67e-172	8	1002	18	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
sp|B1LIM9|BGAL_ECOSM	9.82e-172	9	1027	16	1021	Beta-galactosidase OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_039010-t26_1-p1.