CAZyme Information: TSTA_033310-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_033310-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: capsule-associated protein CAP1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590	EQ962654|CGC18	68369.93	6.0498

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962654:2726259-2728090(+)

Full Sequence      

MRVSRTLYLLCFLTIAAFTLFFLRSPETDTGPKAPFEKSLPADFENLLQPTTEDSHPIAR
LINDANTDFDAKLARQSKSLTEAVEEYRRRYGMPPPPHFDKWFAFAKKRGVQLIDEYDTI
YHSLLPFWALSPRVIRSRVHEALGYDNALIGLLIREGKVTKVEGGGDGYQWQREATVGML
ESFVEYLPDMDLAFNIHDEPRVVVPHEDLHRLVSYAKDTAIPATLEKTSLHNKWSPRPSD
LNKGDRIEEVRTTRFNKFAHQPTWTHSRLSCPVDSPARSLEENPRDNMEPYATSDLGFIH
NTTAFTDICLSPSLRNTFGFFDRPNAFNIVQDLFPIFSQSKISSFQDILYPSPWYWIGKV
SYNATRDYVWEDKISQMYWRGSTTGGFSRDGGWRRQHRQLFVKNVNSASDATIFSQREDG
RWITSNVPRQDVKSLFNVTFTYVGQCDPGDCRAQEEYFDISPSVDQQDAWAYKYLLDIDG
NAFSGRYHAFLRSNSLIYKMALFREWQDEWVDAWVHYVPLGMKGTDAVESVRYFAQEAEG
KIQAPRLAKQGKEWAQKVLRNEDLEVWFFRLLLEYGRLIDDDRENIGFMP

Enzyme Prediction     

No EC number prediction in TSTA_033310-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	312	579	1.6e-79	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.50e-17	335	578	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.03e-10	335	578	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	0.0	1	590	1	590
QKX56622.1|GT90	0.0	1	588	298	886
BCR83603.1|GT90	2.08e-291	1	589	1	599
UCK57446.1|GT90	2.09e-279	1	588	11	617
BAE54850.1|GT90	1.69e-278	1	588	1	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	8.81e-07	312	579	95	342	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.00e-06	335	579	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.19e-59	55	585	151	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.10e-09	328	579	157	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.57e-09	331	579	159	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.72e-07	312	579	123	370	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	2.87e-06	312	579	123	370	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995946	0.004080

TMHMM  Annotations     

Start	End
7	26