CAZyme Information: TSTA_026750-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_026750-t26_1-p1
• CAZy Family: PL26
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531	EQ962654|CGC19	59530.93	5.2330

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962654:934457-936076(+)

Full Sequence      

MPFFRPKTLFPLVAILSIGYDRAALSKIKRPIEQISNTANTITSNKNPPAQVQLPPAHGT
FGNCEFDTASAPPLPFDEWLTRKNFTRAFIRPNRVSASTQFRSLEDINTPVLPPFRALER
GLILSDENDDKTIPCPTVANVNVAIDHDVEETSKLLFGLATTVDRLERLLPSLLYSFADT
KASLLVLVPESDDDLAAQERYFRSRGLDITLESSPLEFTARYFGLVEAFSLHIKQKRPHT
EWVGFIDDDTFFPSLPSVALQLKQADSSKKHYIGSLSEASWQVDTWGHMAFGGGGIFVSK
PLLNILMENYDECQSWGEQPGDQKLGQCIERSSNTPLTLWPSLHQMDLTGAPDGILESGL
QIDSLHHWSTWYTKDVVKMGAVAAVAGKRSVLRRWVFDQQEFIDQSTGESYRMFWVLTNG
HSIVRYTLMPGTPNDAINFDHVELTWNEDMAGYTQRFGAMREKDQEGVIKERYLLTDAIV
IGDNVHQFYTREEENSHNLIEIVWLGPKSSSNSNSNSNSNGASSGGSRNPH

Enzyme Prediction     

EC	2.4.1.-:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.40e-10	225	394	200	375	hypothetical protein; Provisional
398362	DUF604	3.78e-06	289	367	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	6.58e-04	241	380	86	237	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA12680.1|GT31	0.0	1	529	1	528
QKX57029.1|GT31	1.12e-272	1	508	1	516
QMW32971.1|GT31	1.53e-245	1	508	1	509
QMW45004.1|GT31	1.53e-245	1	508	1	509
BAE62723.1|GT31	2.36e-245	1	508	13	521

PDB Hits     

TSTA_026750-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TSTA_026750-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.975581	0.024426

TMHMM  Annotations     

There is no transmembrane helices in TSTA_026750-t26_1-p1.