CAZyme Information: TSTA_026040-t26_2-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_026040-t26_2-p1
• CAZy Family: PL7
• CAZyme Description: glycosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		38289.58	5.7584

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962654:751661-752771(+)

Full Sequence      

MIEAARLVSQLTNIKNTTHLIDNTEIPLVAHQTWKNTHVDTWPDLIRNSVERWMQTVMDT
PMAYFLWNDDGIMEFLEEYEPEFIDHFSALPRMVEKSDIFRILVCKYIGGVYGDVDTRPI
RSPATWIEKSDLKPWRDNATNILYNSTKPVRAIFGIEADCPPDTDTYWRMGYTNPVQLTQ
WALASSPGHPALTWFMQKLYSIIDEVASHHGGNLTTPQAYEELDYLEPLIFTGPDAITVS
LRSWLEDRIGLRWNALTGLHDGGKSKLADDIMILPITGFSPGRGVYGNMGSKPITHHDAR
LQHLAQGSWKGFDLRVEFGKVCRTFFGLCRDWPKS

Enzyme Prediction     

No EC number prediction in TSTA_026040-t26_2-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.16e-14	26	223	82	266	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.03e-10	43	127	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA12609.1|GT32	4.64e-245	1	335	87	421
QKX57092.1|GT32	2.52e-185	1	335	82	415
BCR93027.1|GT32	2.47e-144	1	334	75	406
BCS05686.1|GT32	2.47e-144	1	334	75	406
CAK38082.1|GT32	5.73e-143	1	334	75	406

PDB Hits     

TSTA_026040-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.53e-24	87	310	202	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.18e-19	70	310	145	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	9.56e-16	25	310	129	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.19e-15	26	310	96	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_026040-t26_2-p1.