CAZyme Information: TSTA_019600-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_019600-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207	EQ962656|CGC5	23404.33	4.3194

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:2996027-2996841(+)

Full Sequence      

MSTWMLFDSTKIDVFITSSSVAWYEQDGESRSTIEPKAQHLSCFAGGMVALGAKMFEHTE
DISVARKLVDGCIWGYDSAPLGIMPEVMYIVACEENEDYPKQSSQYSSYTESPVTQSAQK
KAWTMFNNIIQHTVTDIAHAGLDDCTIPHPSEQDRMESFWLAETPKYFYLIFSEPDVGNL
GEYVLNTERINYGDLTDRLKVIVVIHT

Enzyme Prediction     

EC	3.2.1.113:73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	20	188	1.4e-42	0.4125560538116592

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	5.61e-55	25	188	264	447	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	7.58e-30	5	188	323	512	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20647.1|GH47	1.27e-71	21	188	365	576
APA15806.1|GH47	4.83e-50	25	188	372	584
CDF44004.1|GH47	9.39e-50	25	188	372	584
ATZ51000.1|GH47	9.39e-50	25	188	372	584
QDS73448.1|GH47	1.05e-46	35	188	263	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NXC_A	1.41e-14	34	202	292	473	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	3.48e-14	34	188	294	461	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1G6I_A	4.46e-10	20	188	316	522	Crystal structure of the yeast alpha-1,2-mannosidase with bound 1-deoxymannojirimycin at 1.59 A resolution [Saccharomyces cerevisiae]
1DL2_A	5.91e-10	20	188	282	488	Crystal Structure Of Class I Alpha-1,2-mannosidase From Saccharomyces Cerevisiae At 1.54 Angstrom Resolution [Saccharomyces cerevisiae]
5KIJ_A	2.55e-09	37	188	277	445	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q93Y37|MNS3_ARATH	4.46e-16	30	188	415	614	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|Q9NR34|MA1C1_HUMAN	6.98e-15	34	198	444	625	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
sp|P33908|MA1A1_HUMAN	9.55e-15	34	188	467	634	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens OX=9606 GN=MAN1A1 PE=1 SV=3
sp|P45700|MA1A1_MOUSE	8.07e-14	34	202	469	650	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
sp|P53624|MA1A1_DROME	8.10e-14	34	188	474	641	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

There is no transmembrane helices in TSTA_019600-t26_1-p1.