CAZyme Information: TSTA_019580-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_019580-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: GMC oxidoreductase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		65745.96	6.3065

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:2990506-2992406(-)

Full Sequence      

MAFVADGNTFDFIVVGGGTAGNAVAGRLAENPNVRVLVVEAGIPNPDQIEEITTPSKAFT
LRGSKYDWAYKTTMIKRDDYERVEKPNTRGKALGGSTCANYFTWIPGSKPTFDDWEQFGG
SDWTWDNCVEYLRKCATYHDDENLYSSDLKKIGTGGPVNISHADLVPEMKPFRDALTQAW
LDKGGVLTEDIYSGEMRGLTHCVDTIYKGERQGSFLYLKNKPNVTILYGVYSKKLIIDPT
TKVCSGVTVISEVYGTEISVYASREVIVSQGVFETPKLLLLSGIGPAAELAKHGIEPVIE
SPHVGQHLLDHPIVPFVLQLKDGYALDDHILRPGPLNDAAIASYKKDKTGPASSGFLELV
GFPRIDERLNKYPEYREAKVANGGLDPFGPAGQPHFELDFVSLWSSAFQWHYPMPEKGSH
MTVIVDLLRPLSEGQVTLNNANALTQPNINLNFFGNDLDILAMREGIRWTYDVLTKGAGF
KDIVVAEYPWKMPLESDVDMRRVVLDRSQTGFHPCGTARLSKNIHQGVVDPKLRVHGIKN
LRVADASIIPVIPDCRIQNSVYMIGEKAADIIKADHKDIFTAKNVPHFVSMSKL

Enzyme Prediction     

No EC number prediction in TSTA_019580-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	575	1.1e-146	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.99e-91	8	573	4	532	choline dehydrogenase; Validated
225186	BetA	5.79e-87	4	577	2	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.29e-40	430	568	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.19e-22	89	313	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.36e-20	8	565	54	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS00597.1|AA3_2	0.0	1	589	1	589
QKX58151.1|AA3_2	0.0	1	590	1	590
BCS26129.1|AA3_2	0.0	1	589	1	589
QLI65786.1|AA3_2	0.0	1	589	1	589
UNI24682.1|AA3_2	0.0	1	590	1	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	8.60e-306	6	580	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.46e-305	6	580	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	7.04e-305	6	580	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	4.31e-71	10	575	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.33e-70	10	575	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A9AMZ9|BETA_BURM1	6.84e-58	10	590	6	548	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|Q8UH55|BETA_AGRFC	9.43e-58	11	572	4	525	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|B1Z034|BETA_BURA4	1.29e-56	10	590	6	548	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q8G1Z8|BETA_BRUSU	1.29e-56	11	572	4	525	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|Q0B711|BETA_BURCM	1.29e-56	10	590	6	548	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999819	0.000239

TMHMM  Annotations     

There is no transmembrane helices in TSTA_019580-t26_1-p1.