CAZyme Information: TSTA_019480-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_019480-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: acetyl xylan esterase (Axe1), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		29945.72	4.2079

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:2969008-2969999(-)

Full Sequence      

MLSQSLALSILVGGAFSIPVENRANCPNIHVFGARETTVSPGYGSSITVVNDVLNNYPGS
TAEAISYPACGGQSSCGGISYSSSVAQGIAAVASAVNSFNSQCPSSEIVLVGYSQGAEIM
DVALCGGGDPNQGYSNTAVQLSASAVSMVKAAIFMGDPLFRAGLPYEVGTCAAGGFDERP
AGFSCPSAGLIQSYCDSSDPYCCNGNNAATHQGYGAEYGNQAFAFIKSKLSGSSTGGSGG
SGGSGGSGGSGGSGGSGGSGGSGGSGGSSGTVAQWGQCGGQGWTGPTQCVSPYTCTAINS
YYSQCL

Enzyme Prediction     

EC	3.1.1.72:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	25	230	3.5e-42	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.36e-53	26	230	2	173	Cutinase.
395595	CBM_1	9.24e-13	274	302	1	29	Fungal cellulose binding domain.
197593	fCBD	2.35e-11	273	306	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
369775	PE-PPE	1.59e-06	58	131	1	76	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20637.1|CBM1|CE5	1.05e-146	1	306	1	288
AAC39371.1|CE5|3.1.1.72	6.84e-130	1	230	1	233
CAP93909.1|CE5	3.68e-125	1	230	1	234
QKX61131.1|CE5	2.27e-124	1	231	1	237
QQK41864.1|CE5	2.46e-123	1	231	1	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	5.77e-128	25	230	1	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	8.19e-128	26	230	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	1.57e-125	25	230	1	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	1.01e-97	26	231	2	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
6Q8M_A	1.21e-09	273	306	373	406	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	1.22e-130	1	230	1	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	3.49e-111	6	306	8	295	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	2.53e-110	1	306	1	302	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|Q8J0K5|XYNB_TALFU	1.86e-10	273	305	249	281	Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus OX=28572 GN=xynB PE=1 SV=1
sp|Q5ZNB1|XYND_TALFU	2.49e-10	273	306	374	407	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000647	0.999299	CS pos: 23-24. Pr: 0.7818

TMHMM  Annotations     

There is no transmembrane helices in TSTA_019480-t26_1-p1.