CAZyme Information: TSTA_017300-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_017300-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	EQ962656|CGC11	30836.50	5.6108

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:2388247-2389292(-)

Full Sequence      

MQTTIPPSCQQRTRQYWFAFGDSWSATGFQYQLYTTLGIKSDGKYYSPLAIAGATIDNSL
ATWGFGDMTSQIDAFQLYYASRPASAPWTADNTVASFWIGVNDVYYGFAHNDDPSVFVSR
LMNRYRSLIEQIYSNGIRKFLFVNCPPSTRSPQVHEENDLPEQFQRHAEMATAYNEGLNS
MLFQFRDEHKDATVVFYDSFQYMTRVLDDPAEYSYQDATCMNTDRSSCVWWNNLHLVGNI
TTTKLRIWCPFLRLSGGDITLQCIQRKP

Enzyme Prediction     

No EC number prediction in TSTA_017300-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	49	240	3.6e-53	0.7415730337078652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.62e-35	18	235	3	254	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.78e-19	50	236	81	299	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	2.38e-15	18	217	2	208	GDSL-like Lipase/Acylhydrolase.
238141	SGNH_hydrolase	7.65e-05	17	199	1	167	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19551.1|CE16	1.29e-126	16	235	43	289
QKX60132.1|CE16	2.58e-109	5	235	29	288
QMW25447.1|CE16	2.43e-57	7	235	22	275
QMW37516.1|CE16	2.43e-57	7	235	22	275
UCK57868.1|CE16	2.43e-57	7	235	22	275

PDB Hits     

TSTA_017300-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	7.76e-23	71	235	118	280	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	7.76e-23	71	235	118	280	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000002

TMHMM  Annotations     

There is no transmembrane helices in TSTA_017300-t26_1-p1.