CAZyme Information: TSTA_014150-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_014150-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	EQ962656|CGC8	26061.87	3.7644

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:1488670-1489604(-)

Full Sequence      

MAGDGVELQVLFYDDEGWWGIAWLAVYNLTENPDYLNLAISIYNDIQGGVDMPCGGLWWD
KSKGYIASIANELYIALAAGLANHVSSDQAQSYLDAATIGWDWFTNIGVVGDDWLVVDGV
DTSSCEPTGAKWSYNQIAAVELAQATGNSSYLDYAGNISNATTAINGTFPDANGVIKDCT
GGCDIQSDMFKGSLFRGLRQLQLADPHDNWKNFIETNAQSLWNYALKVTNGGECNTGMMF

Enzyme Prediction     

No EC number prediction in TSTA_014150-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	11	231	1.6e-57	0.611731843575419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.08e-20	9	235	82	327	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.89e-11	12	228	91	313	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
395616	Glyco_hydro_9	1.80e-05	13	98	211	285	Glycosyl hydrolase family 9.
395616	Glyco_hydro_9	0.008	90	175	175	255	Glycosyl hydrolase family 9.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX63974.1|GH76	4.07e-124	12	240	99	331
QKX60215.1|GH76	1.72e-117	12	240	65	296
QKX63572.1|GH76	3.19e-116	12	240	98	330
QGA17534.1|GH76	2.48e-112	24	237	24	241
QKX54262.1|GH76	3.65e-81	12	237	110	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	6.90e-10	4	226	125	353	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
4MU9_A	7.14e-09	12	224	116	327	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6Y8F_A	1.36e-08	4	226	126	354	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
4BOK_A	3.01e-08	12	202	88	276	Chain A, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	3.03e-08	12	202	91	279	Chain A, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

TSTA_014150-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000060

TMHMM  Annotations     

There is no transmembrane helices in TSTA_014150-t26_1-p1.