CAZyme Information: TSTA_013860-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_013860-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: isoamyl alcohol oxidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	EQ962656|CGC21	60809.02	4.7552

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:1416373-1418172(+)

Full Sequence      

MKYSWVLATLAVLASASDDATCPTGQCRCMPTDSCWPSASSWAALNSTIGGRLIATVPIG
SPCHDPNYDADACAALQSAWNLPQTHISSSSSIMQTFFANQSCDPFTPESTPCLMGNYVD
YAVNVSSANDVIAAVNFAKKNNIRFVIRNTGHDYFARSTGAGALSVWMHNFNAIQYKNWS
DPHYSGPAFKFGAGVMGFQVLEAAHAKNLVVVGGECPTVGLAGGYIQGGGHSALSTSFGL
GADNTLEFEVVTAAGKLVTANRQQNSDLYWALSGGGAGNYGVVISATVKAHPDAIISGAG
LQFASSSTTPDIFYEAVTQFHSLLPAMIDSGATVIYEIAASFFALNPVTAYNKTSDDVKT
LLTPFLNVLDNLNIPYAVSYTQYNSYYDHYNKYMGPLPYGNLGVGEFQYGGRLIPRDTLN
TNPTAIAAAIRNITEHGVLAVGVGLDVSNPGDVSNAIFPPLRNAAVTMQIGTPWNETAPW
SQMVANQYQMTNEFVPQLEAVTPGSGTYQNEADFRQPDWQNTFFGANYDPLLKIKQTWDP
DHFFYALKAVGSDYWTVDDNGRMCVA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	123	293	5.1e-46	0.3558951965065502

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	6.17e-20	120	261	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.38e-18	82	292	6	205	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	9.14e-11	507	546	1	40	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	1.70e-04	244	292	193	240	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.88e-63	27	564	500	1064
QKD57322.1|CBM91|GH43_11	1.88e-63	27	564	500	1064
QRW06655.1|AA7	2.89e-15	123	553	72	498
QRV77710.1|AA7	2.89e-15	123	553	72	498
UNI23960.1|AA7	6.87e-15	126	292	55	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	3.47e-150	26	566	27	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	5.35e-76	24	564	27	596	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO4_A	5.84e-22	134	544	63	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	1.04e-21	134	544	63	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6FYE_A	4.10e-17	126	291	52	209	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	2.54e-212	23	564	23	561	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	1.52e-182	23	564	25	566	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|A0A075TR33|PATO_PENEN	3.37e-181	6	566	14	567	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|G0R6T3|SORD_HYPJQ	4.52e-169	7	564	12	571	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|G2QDQ9|VAO15_MYCTT	1.78e-149	26	566	27	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999770	CS pos: 16-17. Pr: 0.9726

TMHMM  Annotations     

There is no transmembrane helices in TSTA_013860-t26_1-p1.