CAZyme Information: TSTA_012320-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_012320-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: beta-glucosidase precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835		91476.94	4.9507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:996984-999550(-)

Full Sequence      

MAIPDFDVDSILQQLTLPEKISLVSGRDFWHTTSVPRLKIPAIRLSDGATGVRGIKFFNG
TPAACLPCGTALGATWDPELIEKGGALQAREGILKGASVVLGPTTNIQRSPLGGRGFESF
SEDPFLAGTLAAATIKGLQSNGVAASLKHFACNDQEDHRMSVNAIVTERALREIYLMPFQ
VVQQIYPPWTYMASYNKVNGVHSTENIHLLKEVLREEWGFDGLVMSDWFATYSADKAILA
GLDLEMPGPSYARGAALRHSILPGKVKEYELDACVRQVLRLIKRVLPLGIEEDAEERTDS
NPDTSKLLRSIAAESIVLLKNENAVLPFCPDKFTAVIGPNADFAAFSGGGSTMMTPYYTV
SPLEGIMSECKQVGYSLGCGGWNKLPALSRLTKTKSGLQGLTMAVHLEPSTREKRELLEV
IHVSDSVMDFCDYKHKSMGDDYLFYADFRGTLIPEESANYQFSCSVLGTARVFVDDQLLI
DNATNQVRGDTFFATGTREEFNTIFLEKGRAYEIYVDFGSIATYTLEVASTAPFGGGGLR
LGCTRVFDPQGEIQKAVALAKAAEQVVLCIGLNGEWESEGFDRDNMDLPGYTDELVRAVA
QVNPNTAVIVQSGTPVTMPWVDQVPAILQAWYGGNETGNGIADVIFGKKNPAAKLPLSFP
SRLEDNPSFINFGNQGGRVLYGEDVFVGYRYYEKSKTPVAFPFGHGLSYTSFHFETLQVK
NDGESFLISVDVANTGVADGAQVIQVYVAHIDPLIPRPLKELKGFKKVFIPVGESRVVDI
RVSVRHATSFWDEDRNMWLSAKGDYQLLVGDSSANTPLCHQVTVEENSWWKGLCN

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	247	2.1e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.78e-74	37	816	101	757	beta-glucosidase BglX.
224389	BglX	4.04e-74	27	342	47	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.15e-54	316	709	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.43e-45	10	825	55	778	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.50e-41	37	281	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR61167.1|GH3	0.0	5	833	7	836
SMR64317.1|GH3	0.0	5	833	7	836
SMY29662.1|GH3	0.0	5	833	7	836
UJO24157.1|GH3	0.0	1	833	1	834
SMQ55981.1|GH3	0.0	5	833	7	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.32e-256	6	833	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.57e-251	6	833	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.76e-138	7	824	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.72e-129	12	825	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.81e-103	8	831	4	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	1.26e-298	6	833	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	6.02e-297	4	833	2	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B0Y3M6|BGLI_ASPFC	2.17e-294	7	833	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	8.76e-294	7	833	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	7.09e-293	7	833	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999913	0.000128

TMHMM  Annotations     

There is no transmembrane helices in TSTA_012320-t26_1-p1.