CAZyme Information: TSTA_010130-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_010130-t26_1-p1
• CAZy Family: GT61
• CAZyme Description: endoglucanase-5 precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	EQ962656|CGC7	33327.31	3.8938

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:397600-398696(-)

Full Sequence      

MKANYFPLWALAGSASAYLATTTRYYDGQEGACGCGGSSGLDSWQVGSSSTGFYTAAGSQ
ALFDTDGSSWCGGGCGKCYNLTSTGTSACNGCGEGGVAGESIIVMVTNLCPYNGNEKWCP
SVGSKNDYGYSYHFDIMAESEVFGDNVVVNFEPVACPGQATSDWETCVCYGQTDTDSTPA
GFSTVAGSSEPTATSSTSTAAASSKTSTTLVISTTPVKEVASSSTSSTSTVKPVTETSPA
AVAPTSTVPSVPEGAATTSTYSLTLTTVVTETITVWETPTSTSGSSAAVQTLYGQCGGIN
WTGATTCATGATCKVQNPYYYQCVSSSN

Enzyme Prediction     

EC	3.2.1.4:3	3.2.1.4:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409015	DPBB_GH45_endoglucanase	5.27e-17	20	156	7	149	double-psi beta-barrel fold of glycoside hydrolase family 45 endoglucanase EG27II and similar proteins. This group is made up of endoglucanases from mollusks similar to Ampullaria crossean endoglucanase EG27II, a glycoside hydrolase family 45 (GH45) subfamily B protein. Endoglucanases (EC 3.2.1.4) catalyze the endohydrolysis of (1-4)-beta-D-glucosidic linkages in cellulose, lichenin, and cereal beta-D-glucans. Animal cellulases, such as endoglucanase EG27II, have great potential for industrial applications such as bioethanol production. GH45 endoglucanases from mollusks adopt a double-psi beta-barrel (DPBB) fold.
395595	CBM_1	4.26e-12	292	320	1	29	Fungal cellulose binding domain.
197593	fCBD	3.19e-10	291	324	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19871.1|CBM1|GH45	6.46e-149	1	327	1	338
QGA20713.1|CBM1|GH45	8.90e-107	1	324	1	251
QKX54271.1|CBM1|GH45	3.77e-98	1	328	1	282
UKZ88838.1|CBM1|GH45	9.74e-98	1	325	1	248
UKZ63968.1|CBM1|GH45	1.01e-94	1	324	1	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBU_A	2.43e-27	20	170	25	181	Crystal structure of GH45 endoglucanase EG27II in apo-form [Ampullaria crossean],5XBX_A Crystal structure of GH45 endoglucanase EG27II in complex with cellobiose [Ampullaria crossean],5XC4_A Crystal structure of GH45 endoglucanase EG27II at pH4.0, in complex with cellobiose [Ampullaria crossean],5XC8_A Crystal structure of GH45 endoglucanase EG27II at pH5.5, in complex with cellobiose [Ampullaria crossean],5XC9_A Crystal structure of GH45 endoglucanase EG27II at pH8.0, in complex with cellobiose [Ampullaria crossean]
5XCA_A	3.50e-26	20	170	25	181	Crystal structure of GH45 endoglucanase EG27II D137A mutant in complex with cellobiose [Ampullaria crossean]
1WC2_A	7.93e-21	20	166	17	167	Chain A, ENDOGLUCANASE [Mytilus edulis]
1CBH_A	4.65e-10	290	324	2	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]
5X39_A	8.74e-10	293	324	5	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43317|GUN5_HYPJE	6.55e-92	1	324	1	241	Endoglucanase-5 OS=Hypocrea jecorina OX=51453 GN=egl5 PE=3 SV=1
sp|P82186|GUN_MYTED	4.08e-20	20	166	17	167	Endoglucanase OS=Mytilus edulis OX=6550 PE=1 SV=1
sp|Q9P8P3|GUX1_TRIHA	1.17e-10	279	324	460	505	Exoglucanase 1 OS=Trichoderma harzianum OX=5544 GN=cbh1 PE=1 SV=1
sp|P19355|GUX1_HYPRU	1.20e-09	280	324	470	514	Exoglucanase 1 OS=Hypocrea rufa OX=5547 GN=cbh1 PE=3 SV=2
sp|Q0CFP1|CBHC_ASPTN	2.01e-09	288	324	18	54	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.512759	0.487220

TMHMM  Annotations     

There is no transmembrane helices in TSTA_010130-t26_1-p1.