CAZyme Information: TSTA_009910-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_009910-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		79608.10	5.6612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962656:330153-333311(-)

Full Sequence      

MALRYPGYTRQATKYLISCGFLLLLLFFWLPELSARRYNTWDWTGCPDPSATIAQDIQIV
VRTGGSEPQSRLRSQLSTILSRIPQRNVLILSDMEEEIGSYHVQDVYADLSEQERASYPE
FALYDTQLEYQKQGGNTRELQGGWNLGKYMNLAMKRKIWKMHQESHGGFNFRWFVFLDTD
TFIEWENLLVLLSHLNDAKPLYIGSPVWLPALQFAHGGSAYILSYGAMKALNTPETRDKE
QLLYSQFGFNTTALCCGDEALANVLKSKGVSLKGYWPMFNGEIPAALSFGRDLWCEPVIS
LHHIAGEDMQDLWQWIENWKLRTSSMQPILFKDLFEYVAPQIIGTREDWDNIHGSMKIFP
KSTAAHSSFQNCKAACELDSSCFQFVYDGTTCAVSDHIRVGSKRSPEENPARTYISGWMI
ERIRDWTMKTYLWYLIGILGSVSEESEESLSCYSECAKHCIVPLRERGKYMSVIFYINVP
IGGGVDTLPTFAGIIPFAIMGGVILSKTGRYKPLHFFGFIALTIGFGLFSTLDENPSDAA
WICYQLLCSIGAGCLAGITLPAVQAPLDESDVATATGLWSFTRGFGAIWGVTIPAAVFNN
ECAKHAAMVSNAGVAQKLSGGKAYEYATQAFLNSTSDPTVRAEVIRVFAKSMQTVWYVCL
AFSAPGLIIALFEREVKLRQDLKTEFGIEEDRKDPAAFGVIGLSTVEANAVS

Enzyme Prediction     

No EC number prediction in TSTA_009910-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
341045	MFS_Azr1_MDR_like	7.81e-24	461	593	111	315	Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340868	MFS_TRI12_like	1.63e-13	484	677	301	506	Fungal trichothecene efflux pump (TRI12) of the Major Facilitator Superfamily of transporters. This family includes Fusarium sporotrichioides trichothecene efflux pump (TRI12), which may play a role in F. sporotrichioides self-protection against trichothecenes. TRI12 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340880	MFS_ARN_like	8.04e-11	470	676	311	514	Yeast ARN family of Siderophore iron transporters and similar proteins of the Major Facilitator Superfamily. The ARN family of siderophore iron transporters includes ARN1 (or ferrichrome permease), ARN2 (or triacetylfusarinine C transporter 1 or TAF1), ARN3 (or siderophore iron transporter 1 or SIT1 or ferrioxamine B permease) and ARN4 (or Enterobactin permease or ENB1). They specifically recognize siderophore-iron chelates are expressed under conditions of iron deprivation. They facilitate the uptake of both hydroxamate- and catecholate-type siderophores. This group also includes glutathione exchanger 1 (Gex1p) and Gex2p, which are proton/glutathione antiporters that import glutathione from the vacuole and exports it through the plasma membrane. The ARN family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340879	MFS_MMR_MDR_like	2.37e-10	470	672	184	368	Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
369468	MFS_1	3.63e-05	492	590	248	345	Major Facilitator Superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD43072.1|GT31	3.66e-167	1	430	1	445
ATZ46428.1|GT31	3.66e-167	1	430	1	445
APA09857.1|GT31	6.13e-164	18	430	20	449
SMR45876.1|GT31	1.97e-142	94	428	1	326
SMQ47342.1|GT31	1.11e-141	94	428	1	326

PDB Hits     

TSTA_009910-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KUX1|UCSD_ACRSP	8.15e-73	484	693	364	573	MFS-type transporter ucsD OS=Acremonium sp. OX=2046025 GN=ucsD PE=3 SV=1
sp|S0EEY7|FUS6_GIBF5	6.24e-49	480	692	327	540	Efflux pump FUS6 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) OX=1279085 GN=FUS6 PE=2 SV=1
sp|W7MLD3|FUS6_GIBM7	7.14e-49	480	692	335	548	Efflux pump FUS6 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FUS6 PE=3 SV=1
sp|Q2UPC1|ACLA_ASPOR	9.48e-45	484	705	326	544	MFS efflux transporter aclA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aclA PE=3 SV=1
sp|A0A6J4B6H5|LUC4_FUSSX	3.99e-44	480	690	338	549	MFS-type efflux pump LUC4 OS=Fusarium sp. OX=29916 GN=LUC4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.490934	0.509065	CS pos: 35-36. Pr: 0.4962

TMHMM  Annotations     

Start	End
12	31
484	506
513	531
541	563
576	598
653	672