CAZyme Information: TSTA_006400-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_006400-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: ER glycosyl hydrolase (Edem), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1145		127886.13	6.1668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962660:1664108-1667721(-)

Full Sequence      

MRTRCQCPNIPGLSSPTCLRWVLLALALWLVRVQALKDHEIRDLRLQAEQMFYHGYDNYI
KYAFPEDELRPLTCGPLTRDRDHPERVELNDVLGNYSLTLIDSLSTLGILASSNDTGSRA
WTHFQNGVQEIVRLYGDGSQGPKGQGERARGFDLDSKVQVFETVIRGLGGLLSAHLFAVG
DLPVRGYNPSPEAADYAKAWDKSAFSSSKQPKGIAWSNGFLYDGQLLRLARDLADRLLPA
FYTPTGLPYPRVNLRHGVPFYENSPLSKIYPGQRSDNRKKYTTRFQSRPEVTETCSAGAG
SLILEFATLSRLTGDGRYEDLAKRAFWAVWLRRSEIDLIGAGIDAETGNWVAPFTGVGAG
IDSFFEYAYKSYILLSSGEPPEFDTSSPWSLMDNYFISLEEEHHSPGFYFQVWQDAQDAI
KHHLYRGHGYQHPHYVQADLQTGATRAFWIDSLSAFYPGVLTLAGKIEEATEIHLLATAL
WTRFSALPERWNVATGEIDNGLGWWGGRPEFIESTYYLYRATKDPWYLHVGEMVLRDIKR
RCWTRCGWAGLQDVRTGELQDRMESFFLGETAKYMFLLFDPDHLLNKLDAPFVFTTEGHP
LIFPKSGSTASSPAKSEIENVTDTCELAPVPPPFSFSSTAARPDIFHAASLARLHLMPTR
NEAGGALFDFAQDHPSVTASDLFSPSNYTFYPWTLPPELVPYNAMSSPMSIRPTLDISFP
KLPGMIIGSGSMERVQDGVLLKSIGGLRLGMVQDIPLGIEDGSTGIYTDLFRIQVINNLP
LGRDEKVYLSREIVFDVLSPNDPHFSRVRDPVMLDVVIDVESESTQSKNKNDTKSSRHQK
SKQEQTIIRQESPTLSDDGTFLNGQISTASSVRTALAALMGHISTILGDERGNNLDGDNE
SHYSGNVQSSLFKRKTSSGTSTRLILPAINSIGAGSAPIPDIVDAAIFSHNGKPATTRLT
WSKIYLADELCDHRLPADVPREYQVLVIKRGGCSFSEKLKNIPGYPNSGSSNDSNRLQLV
IVVSYPEHDAGSMFSFYHEGKEAFHASDEQHFYDEQYYQRPFTSTNPNLMQARAALSSES
RLVRPHLEEIQMTSSGLPRREPISMIMVGGGEETYELLRSSTGLGVRRRWIVKSQNVPIG
NLYII

Enzyme Prediction     

No EC number prediction in TSTA_006400-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	51	601	6.6e-143	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.56e-137	51	601	1	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.53e-57	45	605	73	521	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21863.1|GH47	0.0	1	1145	1	1149
QKX55008.1|GH47	0.0	45	1145	382	1642
BCS05200.1|GH47	0.0	1	1145	1	1096
BCR91747.1|GH47	0.0	1	1145	1	1111
BCS16758.1|GH47	0.0	1	1145	1	1096

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	9.56e-33	42	579	11	413	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KIJ_A	4.56e-32	51	601	12	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	5.00e-32	51	601	17	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	5.15e-32	51	601	17	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.43e-31	51	601	95	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.47e-121	12	612	3	484	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q92611|EDEM1_HUMAN	1.78e-107	40	599	129	582	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	1.12e-106	40	599	124	577	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|P38888|MNL1_YEAST	2.14e-103	18	605	3	504	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	2.90e-92	42	601	35	476	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000411	0.999561	CS pos: 35-36. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in TSTA_006400-t26_1-p1.