CAZyme Information: TSTA_004900-t26_3-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_004900-t26_3-p1
• CAZy Family: AA11
• CAZyme Description: MIPC synthase subunit (SurA), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		41216.54	8.9135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962660:1256210-1257417(-)

Full Sequence      

MRRGVVLFILVNVLILSFLVRSVFTLLTLLVEDASADAIHRSDIPSPNSSLIESRPQIIP
KIIHQTYINESIPEHWIEPQQSCINLHPDYEYKLWTNEKSREFIAKEYPWFLETFDGYRY
PIQRADAIRYFVLAYYGGTYIDLDDGCQRRLDPLLSYPAWVRRTKPTGISNDAMGAVPQH
PFFLRVVESLQAYDKHWFLPYITVMYSTGPLFLSVVWKEYMAESFGMDRVRVLMPDEYNR
FSWSFFTHHVGNSWHGADAQLIFWMCRYWVLLTVVGFTLAGCVGFCMWVVYRRLLLLGHR
YRYTRLAPGGISVSKIRRRPFARMPRFFRRISSSSIYSDEESGRKEGAYSE

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	78	155	3.4e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.15e-70	5	280	14	306	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.25e-25	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21998.1|GT32	9.73e-232	1	351	1	351
QKX60032.1|GT32	1.45e-195	1	349	1	344
QMW44769.1|GT32	2.61e-187	1	343	1	344
BAE61832.1|GT32	2.61e-187	1	343	1	344
QRD84258.1|GT32	2.61e-187	1	343	1	344

PDB Hits     

TSTA_004900-t26_3-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	6.44e-101	1	262	1	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	7.54e-101	1	312	1	305	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.09e-84	37	279	56	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.53e-84	48	277	46	277	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	8.85e-55	59	293	64	301	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.193459	0.806524	CS pos: 36-37. Pr: 0.6124

TMHMM  Annotations     

Start	End
5	27
198	217
269	291