CAZyme Information: TSTA_001080-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_001080-t26_1-p1
• CAZy Family: GT76
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase SUR1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		39807.93	7.7485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962660:263535-264758(-)

Full Sequence      

MASVRVRLFTLIIIMFLLSQRWWLPLGHIFFNLVALSSRWHYASAEAFISKEHDDFDVTF
ASYAANQSTSGFGYGDVIPPIMHHINLGSKQPRPEWMAARDECIRYHPHWKAYIWDDGAS
ERLVREEFPHLKDMWDNYRFPVERVDALRYMILQTYGGVVLDFDLSCKRSLGPLRRFEFV
APAAHPTGFSIGFMMSSQGNPFVQELVNNLPRYNYVWFFLPYVAVMFSTGCHYASTIFTL
QEHHSTLRILGGIPGSPHLHMLNGFAETPLFRHLGSSSWHSFDASLINWLGHLNKGSVIG
LTVVSFMTSVIIILCLMCLRRNYCSTLRSGSSIDKYCLDSGITCIKEA

Enzyme Prediction     

No EC number prediction in TSTA_001080-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.77e-20	29	293	18	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.79e-11	95	178	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20976.1|GT32	1.73e-184	1	348	1	347
QKX57091.1|GT32	6.04e-153	18	325	18	327
QRD92706.1|GT32	8.53e-117	31	316	30	316
QMW36301.1|GT32	8.53e-117	31	316	30	316
QMW48357.1|GT32	2.43e-116	31	316	30	316

PDB Hits     

TSTA_001080-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.39e-33	77	290	54	262	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.24e-32	78	292	57	267	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.23e-31	77	290	61	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.22e-28	66	295	52	277	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	4.32e-25	77	289	81	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.955596	0.044437

TMHMM  Annotations     

Start	End
216	238
297	319